Protein Family IF04299

Metagenome Isolate
125 Members
71 Samples
101 Scaffolds
513.63 Avg Length

🧬 Representative Sequence

ID
3300038395|Ga0415639_037948|Ga0415639_037948_3117_4934
Length
605 aa
Sequence
LAEITRNPLTTGVTLSGGEPMDQADALIPVAKSLKERGYDLWIYTGYLWEDLDGAKKTLSMLADVIVDGPYDASLRSLTLPWRGSSNQRLIDVXKKRALFSVSDKTGVCEFARRCSALGYEIISTGGTQEALEESGIAVTNVSAVTGFPECLGGRLKTLHPAIHGGILAMRDNRDHMAQLDVLNIGVIDIVVINLYPFKQTIQIPGVHLDEAIENIDVGGPALIRSAAKNWPDVVVAVDPYDYDDILDQLENGGVSRERRFELACKVFEHTAHYDAVIADYLRRQAGISFPETFTLTYEKAQDLRYGENPHQAAAFYRGFGRLQGTLAKAEHLHGKELSFCNINDSAAAIAVVKEFDQPCAVAVKHATPCGVGVGGSICEAYLKAHDADPVSIFGGIVALNRICDTVTAEEMAKTHLDIIIAPGYTDEAIEVLTQKKNVRILALENICDPMPEGTLDFKKVQGGLLIQEADRTSFDPAALKIMTKREPTPGELESLDFAWRVCKHVKSNAIVLAADGRTSGIGPGQVNRFIAAEIAIRQAGERAKGSVMASDAFLPFCDCVEAAGAAGVTAIIQPGGSVRDRESIDKADELGIAMVFTGERHFKH

📊 Sample Types

Isolate 19.2%
Metagenome 80.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 37.1%
Termitidae 32.9%
Kalotermitidae 14.3%
Formicidae 7.1%
Termopsidae 4.3%
Rhinotermitidae 1.4%
Hodotermitidae 1.4%
Ixodidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 120
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2603880173 Pseudomonas SP. Isolate Unclassified
2 2687453755 Pseudomonadales bacterium Cag27 Isolate Unclassified
3 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
4 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
5 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
6 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
11 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
12 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 2687453754 Pseudomonadales bacterium Cag26 Isolate Unclassified
15 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
16 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
17 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
18 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
21 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
22 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
27 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
28 2820735654 Unclassified Bacteroidetes Th196P4bin9 Isolate Unclassified
29 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
30 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
31 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
32 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 2772190889 Unclassified Elusimicrobia Cu122P5_bin43 Isolate Unclassified
35 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
36 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
37 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
38 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
39 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
40 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
41 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
42 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
44 2820931684 Unclassified Actinobacteria Emb289P1bin89 Isolate Unclassified
45 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
46 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
47 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
48 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
49 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
50 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
51 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
52 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
53 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
54 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
55 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
56 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
57 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
58 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
59 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
60 2599185121 Rickettsiales bacterium Ac37b Isolate Ixodidae
61 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
62 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
63 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
64 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
65 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
66 2687453756 Pseudomonadales bacterium Cag32 Isolate Unclassified
67 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
68 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
69 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
70 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
71 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_167311 3300042601 Bacteria 8965
2 Ga0466697_019925 3300042611 Bacteria 8332
3 Ga0466711_285127 3300042615 Bacteria 62198
4 Ga0466723_270019 3300042618 Bacteria 3048
5 Ga0466728_258451 3300042620 Bacteria 22159
6 Ga0123355_10022625 3300009826 Bacteria 10078
7 Ga0123356_10000001 3300010049 Bacteria 411946
8 Ga0123356_10003072 3300010049 Bacteria 17631
9 Ga0123356_10008458 3300010049 Bacteria 10232
10 Ga0123353_10050804 3300010167 Bacteria 6614
11 Ga0123353_10157802 3300010167 Bacteria 3614
12 Ga0466729_314796 3300042621 Bacteria 6779
13 Ga0466704_312129 3300042643 Bacteria 70462
14 Ga0466704_604528 3300042643 Bacteria 13454
15 Ga0466727_172755 3300042655 Bacteria 3601
16 Ga0415639_003695 3300038395 Bacteria 27560
17 JGI24702J35022_10000489 3300002462 Bacteria 23998
18 Ga0072941_1239139 3300005201 Bacteria 4155
19 Ga0466697_142393 3300042611 Bacteria 2035
20 Ga0466714_155166 3300042603 Bacteria 6029
21 Ga0466714_157011 3300042603 Bacteria 21234
22 Ga0466710_174897 3300042613 Bacteria 1724
23 Ga0123357_10021525 3300009784 Bacteria 8633
24 Ga0466730_045222 3300042625 Bacteria 4555
25 Ga0466704_278504 3300042643 Bacteria 29381
26 Ga0466724_14567 3300042649 Bacteria 3755
27 Ga0415639_002947 3300038395 Bacteria 16843
28 JGI24705J35276_12224769 3300002504 Bacteria 2646
29 Ga0466705_171514 3300042612 Bacteria 66002
30 Ga0466705_285876 3300042612 Bacteria 3201
31 Ga0466732_176116 3300042656 Bacteria 2342
32 Ga0466716_084081 3300042605 Bacteria 6891
33 Ga0466715_202163 3300042616 Bacteria 11731
34 Ga0466723_214381 3300042618 Bacteria 4670
35 Ga0123355_10094035 3300009826 Bacteria 4743
36 Ga0123356_10005206 3300010049 Bacteria 13295
37 Ga0123356_10170654 3300010049 Bacteria 2185
38 Ga0466735_052889 3300042624 Bacteria 3930
39 Ga0466735_088935 3300042624 Bacteria 3132
40 Ga0466702_144479 3300042635 Bacteria 15823
41 Ga0466703_175180 3300042636 Bacteria 33044
42 Ga0466693_122129 3300042592 Bacteria 2209
43 Ga0466701_067390 3300042598 Bacteria 13666
44 Ga0466713_119761 3300042602 Bacteria 47658
45 Ga0466714_005312 3300042603 Bacteria 30939
46 Ga0466710_256075 3300042613 Bacteria 2408
47 Ga0123356_10081001 3300010049 Bacteria 3070
48 Ga0415639_033766 3300038395 Bacteria 11394
49 Ga0466696_067032 3300042596 Bacteria 12054
50 Ga0068305_10142877 3300005083 Unclassified 8273
51 Ga0123357_10078493 3300009784 Bacteria 4350
52 Ga0123356_10039927 3300010049 Bacteria 4372
53 Ga0123353_10010671 3300010167 Bacteria 12839
54 Ga0123353_10341484 3300010167 Unclassified 2261
55 Ga0466704_226850 3300042643 Bacteria 16106
56 Ga0415639_013522 3300038395 Bacteria 6785
57 Ga0415639_037948 3300038395 Bacteria 12417
58 Ga0415639_052004 3300038395 Bacteria 6052
59 Ga0466657_018508 3300042582 Bacteria 12026
60 Ga0103266_1000042 3300007067 Bacteria 115372
61 Ga0102737_1005095 3300007142 Bacteria 2672
62 Ga0103264_1000704 3300007188 Bacteria 15873
63 Ga0466700_390130 3300042600 Bacteria 4593
64 Ga0466715_451370 3300042616 Bacteria 5074
65 Ga0466723_116116 3300042618 Unclassified 8724
66 Ga0466726_215447 3300042619 Bacteria 6683
67 Ga0123353_10000970 3300010167 Bacteria 35107
68 Ga0466731_195536 3300042622 Bacteria 24605
69 Ga0415639_001400 3300038395 Bacteria 43729
70 Ga0415639_056686 3300038395 Bacteria 5266
71 JGI24702J35022_10000078 3300002462 Bacteria 42674
72 JGI24696J40584_12961537 3300002834 Bacteria 20161
73 CVPL005W_1000568 3300002934 Bacteria 13919
74 Ga0103261_1001391 3300007083 Unclassified 3862
75 Ga0103264_1001400 3300007188 Bacteria 10601
76 Ga0466701_048211 3300042598 Bacteria 18382
77 Ga0466706_132633 3300042599 Bacteria 1878
78 Ga0466700_349095 3300042600 Bacteria 27617
79 Ga0466719_149752 3300042606 Bacteria 9684
80 Ga0123356_10024470 3300010049 Bacteria 5681
81 Ga0123353_10223367 3300010167 Bacteria 2943
82 Ga0123354_10000432 3300010882 Bacteria 40956
83 Ga0466702_176719 3300042635 Bacteria 7033
84 Ga0466703_314665 3300042636 Bacteria 6981
85 Ga0466694_309797 3300042594 Bacteria 26951
86 Ga0068305_10031778 3300005083 Bacteria 28053
87 Ga0466733_145568 3300042659 Bacteria 8857
88 Ga0466714_147954 3300042603 Bacteria 24894
89 Ga0466705_437942 3300042612 Bacteria 13406
90 Ga0466711_261053 3300042615 Bacteria 39528
91 Ga0123357_10091958 3300009784 Bacteria 3948
92 Ga0123355_10001249 3300009826 Unclassified 35457
93 Ga0123356_10002388 3300010049 Bacteria 20100
94 Ga0123353_10000717 3300010167 Bacteria 40404
95 Ga0123353_10018060 3300010167 Bacteria 10408
96 Ga0123353_10022021 3300010167 Bacteria 9589
97 Ga0123353_10406522 3300010167 Bacteria 2024
98 Ga0123354_10044176 3300010882 Bacteria 6838
99 Ga0466703_119440 3300042636 Bacteria 3416
100 JGI24702J35022_10038433 3300002462 Bacteria 2555
101 JGI24705J35276_12238804 3300002504 Bacteria 106703

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme 227 539 0.98
PF02142 MGS MGS-like domain 108 221 0.96
PF13353 Fer4_12 4Fe-4S single cluster domain 6 91 0.93

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.