Protein Family IF04265
Metagenome
Isolate
150
Members
60
Samples
134
Scaffolds
405.31
Avg Length
Representative Sequence
- ID
- 3300038395|Ga0415639_000337|Ga0415639_000337_1388_2683
- Length
- 431 aa
- Sequence
- LTTGWASATLTLRIKSAEERLGIALQYTRHADEAITKLTKMFGAVLVTGARQVGKTTLLQEAAKHAGYVSLDDKIQLAHAVRQSGSFFKDNPPPVFIDEIQYAPNLFSQIKIILDKSKKKGQFFLSGSQQFEMMKNVSESLAGRLGILNLPGISLRERLGISVRKPFLPTEEYFSCRQKELAEIPYSDVWKIIHRGSFPELCANPDFDWQMFFAAYVKTYIERDVRSLAQVGDEIKFLQFMTIAASCTGQLLNLASLARDVGISQPTAERWLSILVTSNLIFLLTPYHNNIAKRTIKTPKLYFSDTGLAAYLTRWNTPEVIKNGAMAGAFFETFIIGEILKSYSNNGILNPPFYFYRDRDGNEIDLLIEDSGTLYPIEIKKHADPDKSDISKFFILNKIPSVKRGQGGVICLYDNLVTLDGRDKAIPISLL
Sample Types
Isolate
10.7%
Metagenome
89.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.3%
Unclassified
30.0%
Kalotermitidae
20.0%
Termopsidae
5.0%
Rhinotermitidae
5.0%
Hodotermitidae
1.7%
Taxonomy
Archaea
2
Bacteria
141
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2740892547 | Fibrobacteria bacterium GUT77 MC_77 | Isolate | Unclassified |
| 2 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 3 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 4 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 5 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 6 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 7 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 8 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 9 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 10 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 16 | 2820731983 | Unclassified Chloroflexi Nt197P3bin126 | Isolate | Unclassified |
| 17 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 18 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 19 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 20 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 23 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 2820075487 | Unclassified Proteobacteria Nt197P3bin122 | Isolate | Unclassified |
| 29 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 30 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 31 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 32 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 33 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 38 | 2820004052 | Unclassified Synergistetes Nt197P3bin25 | Isolate | Unclassified |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 41 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 42 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 43 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 44 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 45 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 46 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 47 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 48 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 49 | 2820229114 | Unclassified Firmicutes Th196P4bin40 | Isolate | Unclassified |
| 50 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 51 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 52 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 53 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 54 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 55 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 56 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 57 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 58 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 59 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 60 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10001070 | 3300009826 | Bacteria | 37822 |
| 2 | Ga0123356_10055294 | 3300010049 | Bacteria | 3697 |
| 3 | Ga0123356_10389557 | 3300010049 | Bacteria | 1528 |
| 4 | Ga0466705_002773 | 3300042612 | Bacteria | 52043 |
| 5 | Ga0466705_209146 | 3300042612 | Bacteria | 1290 |
| 6 | Ga0415639_001863 | 3300038395 | Bacteria | 2742 |
| 7 | Ga0466691_067248 | 3300042593 | Bacteria | 1384 |
| 8 | Ga0466694_173904 | 3300042594 | Unclassified | 2662 |
| 9 | Ga0466694_322785 | 3300042594 | Bacteria | 4284 |
| 10 | Ga0466694_390939 | 3300042594 | Bacteria | 4447 |
| 11 | Ga0466705_402049 | 3300042612 | Bacteria | 1620 |
| 12 | Ga0466711_432269 | 3300042615 | Bacteria | 5039 |
| 13 | Ga0466715_224881 | 3300042616 | Bacteria | 2858 |
| 14 | JGI24702J35022_10005511 | 3300002462 | Bacteria | 7383 |
| 15 | Ga0466706_129924 | 3300042599 | Bacteria | 63906 |
| 16 | Ga0466707_381463 | 3300042601 | Archaea | 2306 |
| 17 | Ga0466722_257096 | 3300042609 | Bacteria | 2819 |
| 18 | Ga0123357_10033282 | 3300009784 | Bacteria | 7003 |
| 19 | Ga0123357_10256365 | 3300009784 | Bacteria | 1859 |
| 20 | Ga0123356_10307756 | 3300010049 | Bacteria | 1692 |
| 21 | Ga0123353_10402896 | 3300010167 | Bacteria | 2035 |
| 22 | Ga0123353_10449007 | 3300010167 | Bacteria | 1899 |
| 23 | Ga0123353_10463899 | 3300010167 | Bacteria | 1860 |
| 24 | Ga0466697_183929 | 3300042611 | Bacteria | 1483 |
| 25 | Ga0466705_012433 | 3300042612 | Bacteria | 1813 |
| 26 | Ga0466705_074325 | 3300042612 | Bacteria | 2487 |
| 27 | Ga0415639_000337 | 3300038395 | Unclassified | 5333 |
| 28 | Ga0415639_025725 | 3300038395 | Bacteria | 11770 |
| 29 | Ga0466729_240068 | 3300042621 | Bacteria | 1756 |
| 30 | Ga0466729_284504 | 3300042621 | Unclassified | 1615 |
| 31 | Ga0466728_146640 | 3300042620 | Bacteria | 4197 |
| 32 | Ga0466729_029038 | 3300042621 | Bacteria | 10274 |
| 33 | JGI24702J35022_10000554 | 3300002462 | Bacteria | 22594 |
| 34 | JGI24702J35022_10028105 | 3300002462 | Bacteria | 3024 |
| 35 | Ga0466700_371918 | 3300042600 | Bacteria | 1425 |
| 36 | Ga0466714_004005 | 3300042603 | Bacteria | 23670 |
| 37 | Ga0466717_009672 | 3300042604 | Bacteria | 1975 |
| 38 | Ga0123355_10011476 | 3300009826 | Bacteria | 13663 |
| 39 | Ga0123353_10078854 | 3300010167 | Bacteria | 5294 |
| 40 | Ga0123353_10085294 | 3300010167 | Bacteria | 5086 |
| 41 | Ga0466693_149620 | 3300042592 | Bacteria | 3032 |
| 42 | Ga0466731_038924 | 3300042622 | Bacteria | 2417 |
| 43 | Ga0466735_069787 | 3300042624 | Bacteria | 1840 |
| 44 | Ga0466703_285939 | 3300042636 | Bacteria | 16065 |
| 45 | Ga0466711_151115 | 3300042615 | Bacteria | 12217 |
| 46 | Ga0466715_478496 | 3300042616 | Bacteria | 2189 |
| 47 | JGI24702J35022_10004996 | 3300002462 | Bacteria | 7825 |
| 48 | JGI24696J40584_12944197 | 3300002834 | Bacteria | 1803 |
| 49 | JGI24696J40584_12957440 | 3300002834 | Bacteria | 3516 |
| 50 | Ga0123357_10003406 | 3300009784 | Bacteria | 18194 |
| 51 | Ga0466707_277223 | 3300042601 | Bacteria | 23569 |
| 52 | Ga0466721_036357 | 3300042608 | Bacteria | 3542 |
| 53 | Ga0466722_140102 | 3300042609 | Bacteria | 1843 |
| 54 | Ga0123355_10240712 | 3300009826 | Bacteria | 2564 |
| 55 | Ga0123356_10000146 | 3300010049 | Bacteria | 79460 |
| 56 | Ga0123356_10423649 | 3300010049 | Bacteria | 1474 |
| 57 | Ga0123353_10000051 | 3300010167 | Bacteria | 130638 |
| 58 | Ga0123353_10124912 | 3300010167 | Bacteria | 4135 |
| 59 | Ga0466705_382576 | 3300042612 | Bacteria | 40211 |
| 60 | Ga0466691_197357 | 3300042593 | Bacteria | 6055 |
| 61 | Ga0466731_282812 | 3300042622 | Bacteria | 3247 |
| 62 | Ga0466703_090889 | 3300042636 | Bacteria | 4859 |
| 63 | Ga0466708_006183 | 3300042652 | Bacteria | 5118 |
| 64 | Ga0466705_448639 | 3300042612 | Bacteria | 2910 |
| 65 | Ga0466711_176332 | 3300042615 | Bacteria | 26503 |
| 66 | Ga0072940_1052505 | 3300005200 | Bacteria | 10385 |
| 67 | Ga0466707_298598 | 3300042601 | Bacteria | 65618 |
| 68 | Ga0123357_10205633 | 3300009784 | Bacteria | 2228 |
| 69 | Ga0123355_10075434 | 3300009826 | Bacteria | 5397 |
| 70 | Ga0123355_10178262 | 3300009826 | Bacteria | 3160 |
| 71 | Ga0123356_10327272 | 3300010049 | Bacteria | 1648 |
| 72 | Ga0123356_10419530 | 3300010049 | Bacteria | 1480 |
| 73 | Ga0123353_10024311 | 3300010167 | Bacteria | 9195 |
| 74 | Ga0123354_10180304 | 3300010882 | Unclassified | 2414 |
| 75 | Ga0466705_058514 | 3300042612 | Bacteria | 4601 |
| 76 | Ga0466705_097312 | 3300042612 | Bacteria | 4284 |
| 77 | Ga0466705_118322 | 3300042612 | Bacteria | 3502 |
| 78 | Ga0415639_016119 | 3300038395 | Bacteria | 2809 |
| 79 | Ga0466703_009535 | 3300042636 | Bacteria | 3451 |
| 80 | Ga0466703_198745 | 3300042636 | Bacteria | 1516 |
| 81 | Ga0466704_401520 | 3300042643 | Bacteria | 28205 |
| 82 | Ga0466711_153596 | 3300042615 | Bacteria | 3277 |
| 83 | Ga0466711_283762 | 3300042615 | Bacteria | 1384 |
| 84 | Ga0466706_220958 | 3300042599 | Bacteria | 79026 |
| 85 | Ga0466713_026803 | 3300042602 | Bacteria | 64874 |
| 86 | Ga0466717_183151 | 3300042604 | Bacteria | 6900 |
| 87 | Ga0466698_133210 | 3300042610 | Bacteria | 1576 |
| 88 | Ga0123355_10383936 | 3300009826 | Bacteria | 1827 |
| 89 | Ga0123354_10155996 | 3300010882 | Bacteria | 2738 |
| 90 | Ga0466697_206438 | 3300042611 | Bacteria | 2936 |
| 91 | Ga0466705_041659 | 3300042612 | Bacteria | 3886 |
| 92 | Ga0466705_279176 | 3300042612 | Bacteria | 33778 |
| 93 | Ga0466690_340450 | 3300042590 | Bacteria | 2013 |
| 94 | Ga0466696_204983 | 3300042596 | Bacteria | 1657 |
| 95 | Ga0466696_342625 | 3300042596 | Bacteria | 17848 |
| 96 | Ga0466725_184103 | 3300042654 | Bacteria | 3397 |
| 97 | Ga0466711_146772 | 3300042615 | Bacteria | 10567 |
| 98 | Ga0466726_167066 | 3300042619 | Bacteria | 3695 |
| 99 | Ga0466719_030760 | 3300042606 | Bacteria | 4481 |
| 100 | Ga0466720_044870 | 3300042607 | Bacteria | 5979 |
| 101 | Ga0466722_006308 | 3300042609 | Unclassified | 2231 |
| 102 | Ga0466698_237384 | 3300042610 | Bacteria | 1906 |
| 103 | Ga0123353_10003548 | 3300010167 | Bacteria | 19751 |
| 104 | Ga0123353_10340197 | 3300010167 | Bacteria | 2266 |
| 105 | Ga0123354_10107671 | 3300010882 | Bacteria | 3710 |
| 106 | Ga0466692_001523 | 3300042591 | Bacteria | 1587 |
| 107 | Ga0466694_398736 | 3300042594 | Bacteria | 2702 |
| 108 | Ga0466709_287667 | 3300042648 | Bacteria | 1955 |
| 109 | Ga0466725_440786 | 3300042654 | Bacteria | 3233 |
| 110 | Ga0466727_125639 | 3300042655 | Bacteria | 2427 |
| 111 | JGI24696J40584_12954042 | 3300002834 | Bacteria | 2573 |
| 112 | Ga0466706_289435 | 3300042599 | Unclassified | 3039 |
| 113 | Ga0466707_164803 | 3300042601 | Bacteria | 2118 |
| 114 | Ga0466707_283194 | 3300042601 | Bacteria | 2011 |
| 115 | Ga0466713_050115 | 3300042602 | Bacteria | 8029 |
| 116 | Ga0466717_285491 | 3300042604 | Bacteria | 1735 |
| 117 | Ga0466697_053569 | 3300042611 | Bacteria | 3245 |
| 118 | Ga0123357_10149158 | 3300009784 | Bacteria | 2845 |
| 119 | Ga0123355_10008488 | 3300009826 | Bacteria | 15518 |
| 120 | Ga0123355_10021572 | 3300009826 | Unclassified | 10311 |
| 121 | Ga0123356_10068374 | 3300010049 | Bacteria | 3327 |
| 122 | Ga0123353_10142263 | 3300010167 | Bacteria | 3841 |
| 123 | Ga0123353_10397175 | 3300010167 | Bacteria | 2054 |
| 124 | Ga0123353_10554816 | 3300010167 | Bacteria | 1656 |
| 125 | Ga0466705_013347 | 3300042612 | Bacteria | 2353 |
| 126 | Ga0466690_216422 | 3300042590 | Bacteria | 2313 |
| 127 | Ga0466702_222341 | 3300042635 | Bacteria | 2361 |
| 128 | Ga0466702_365561 | 3300042635 | Bacteria | 3382 |
| 129 | Ga0466705_446349 | 3300042612 | Bacteria | 6578 |
| 130 | Ga0466710_201425 | 3300042613 | Bacteria | 2838 |
| 131 | Ga0466715_176272 | 3300042616 | Archaea | 2294 |
| 132 | Ga0466701_019386 | 3300042598 | Bacteria | 3383 |
| 133 | Ga0466707_116235 | 3300042601 | Bacteria | 3892 |
| 134 | Ga0466720_047067 | 3300042607 | Bacteria | 74192 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.