Protein Family IF04164
Metagenome
Isolate
138
Members
41
Samples
134
Scaffolds
151.96
Avg Length
Representative Sequence
- ID
- 3300024493|Ga0264413_106339|Ga0264413_1063392
- Length
- 144 aa
- Sequence
- MKILVDADSCPRAARELALRCSGRRRIQVVFAANRPMPGISGENVIMEICPPGENSADDRLVELAAAGDLAKRLLEKDVIVIDDRGRLFTLDNINELLSLRNFTVGLAENGLGIERTANYGKKELKAFADALDRQITKIINNGS
Sample Types
Isolate
2.9%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Kalotermitidae
28.9%
Unclassified
13.2%
Rhinotermitidae
5.3%
Termopsidae
2.6%
Taxonomy
Archaea
0
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 11 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 17 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 18 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 19 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 20 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 33 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 34 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 35 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 36 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 37 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 38 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_118613 | 3300024493 | Bacteria | 3364 |
| 2 | Ga0466690_311327 | 3300042590 | Bacteria | 4389 |
| 3 | Ga0466694_310178 | 3300042594 | Bacteria | 1048 |
| 4 | Ga0466694_346750 | 3300042594 | Bacteria | 13755 |
| 5 | Ga0466699_013984 | 3300042597 | Bacteria | 2716 |
| 6 | Ga0466699_066384 | 3300042597 | Bacteria | 1336 |
| 7 | Ga0466699_068820 | 3300042597 | Bacteria | 1256 |
| 8 | Ga0466699_150332 | 3300042597 | Bacteria | 9436 |
| 9 | Ga0466699_245560 | 3300042597 | Bacteria | 1356 |
| 10 | Ga0466707_329942 | 3300042601 | Bacteria | 2140 |
| 11 | Ga0466722_121453 | 3300042609 | Bacteria | 2817 |
| 12 | Ga0466722_224732 | 3300042609 | Bacteria | 9570 |
| 13 | Ga0466698_242907 | 3300042610 | Bacteria | 1253 |
| 14 | AustNasuHG_c1000171 | 3300000089 | Bacteria | 21002 |
| 15 | FAAS_10305196 | 3300001880 | Bacteria | 591 |
| 16 | JGI24698J34947_10019462 | 3300002449 | Bacteria | 3661 |
| 17 | Ga0072940_1000036 | 3300005200 | Bacteria | 5930 |
| 18 | Ga0072940_1009319 | 3300005200 | Bacteria | 6757 |
| 19 | Ga0072941_1184466 | 3300005201 | Bacteria | 2299 |
| 20 | Ga0074263_105094 | 3300005485 | Bacteria | 1667 |
| 21 | Ga0466705_068536 | 3300042612 | Bacteria | 3719 |
| 22 | Ga0466703_130931 | 3300042636 | Bacteria | 4349 |
| 23 | Ga0466708_108618 | 3300042652 | Bacteria | 24572 |
| 24 | Ga0123356_10042658 | 3300010049 | Bacteria | 4224 |
| 25 | Ga0466712_052003 | 3300042614 | Bacteria | 5345 |
| 26 | Ga0466712_302776 | 3300042614 | Bacteria | 3124 |
| 27 | Ga0466718_064859 | 3300042617 | Bacteria | 21008 |
| 28 | Ga0466728_194272 | 3300042620 | Bacteria | 1343 |
| 29 | Ga0264413_125284 | 3300024493 | Unclassified | 8047 |
| 30 | Ga0466694_178677 | 3300042594 | Bacteria | 2089 |
| 31 | Ga0466699_134662 | 3300042597 | Bacteria | 7108 |
| 32 | Ga0466699_315238 | 3300042597 | Bacteria | 5256 |
| 33 | Ga0466714_036867 | 3300042603 | Bacteria | 1804 |
| 34 | Ga0466716_392321 | 3300042605 | Bacteria | 5416 |
| 35 | Ga0466720_042088 | 3300042607 | Bacteria | 4122 |
| 36 | FAAS_10252355 | 3300001880 | Bacteria | 563 |
| 37 | JGI24698J34947_10015008 | 3300002449 | Bacteria | 4218 |
| 38 | Ga0072941_1015842 | 3300005201 | Bacteria | 3211 |
| 39 | Ga0072941_1027538 | 3300005201 | Bacteria | 3462 |
| 40 | Ga0072941_1053271 | 3300005201 | Bacteria | 5687 |
| 41 | Ga0466705_049931 | 3300042612 | Bacteria | 17901 |
| 42 | Ga0466727_345077 | 3300042655 | Bacteria | 5699 |
| 43 | Ga0466705_411325 | 3300042612 | Bacteria | 6453 |
| 44 | Ga0466691_010662 | 3300042593 | Bacteria | 3847 |
| 45 | Ga0466722_008955 | 3300042609 | Bacteria | 11922 |
| 46 | JGI24698J34947_10001789 | 3300002449 | Bacteria | 11464 |
| 47 | JGI24698J34947_10167589 | 3300002449 | Bacteria | 893 |
| 48 | JGI24695J34938_10011742 | 3300002450 | Bacteria | 4699 |
| 49 | JGI24695J34938_10424246 | 3300002450 | Bacteria | 597 |
| 50 | Ga0074263_103175 | 3300005485 | Bacteria | 2831 |
| 51 | Ga0466731_087665 | 3300042622 | Bacteria | 1295 |
| 52 | Ga0123355_10030428 | 3300009826 | Bacteria | 8748 |
| 53 | Ga0466712_021690 | 3300042614 | Bacteria | 45968 |
| 54 | Ga0466711_099285 | 3300042615 | Bacteria | 4705 |
| 55 | Ga0264413_135542 | 3300024493 | Bacteria | 1289 |
| 56 | Ga0466690_382246 | 3300042590 | Bacteria | 5664 |
| 57 | Ga0466694_192495 | 3300042594 | Bacteria | 1534 |
| 58 | Ga0466699_066319 | 3300042597 | Bacteria | 2314 |
| 59 | Ga0466701_032668 | 3300042598 | Bacteria | 1190 |
| 60 | Ga0466720_110476 | 3300042607 | Bacteria | 1485 |
| 61 | Ga0466720_177676 | 3300042607 | Bacteria | 91443 |
| 62 | Ga0466720_194796 | 3300042607 | Bacteria | 5719 |
| 63 | JGI24698J34947_10003186 | 3300002449 | Bacteria | 8890 |
| 64 | JGI24698J34947_10027076 | 3300002449 | Bacteria | 3043 |
| 65 | JGI24698J34947_10162944 | 3300002449 | Bacteria | 911 |
| 66 | Ga0072940_1216967 | 3300005200 | Bacteria | 1107 |
| 67 | Ga0466705_125277 | 3300042612 | Bacteria | 2524 |
| 68 | Ga0466732_052426 | 3300042656 | Bacteria | 4206 |
| 69 | Ga0123353_10541696 | 3300010167 | Bacteria | 1682 |
| 70 | Ga0466712_244775 | 3300042614 | Unclassified | 1092 |
| 71 | Ga0466715_559922 | 3300042616 | Bacteria | 5168 |
| 72 | Ga0466691_001852 | 3300042593 | Bacteria | 4316 |
| 73 | Ga0466700_141504 | 3300042600 | Bacteria | 2119 |
| 74 | Ga0466719_518056 | 3300042606 | Bacteria | 1717 |
| 75 | Ga0466720_016498 | 3300042607 | Unclassified | 2089 |
| 76 | Ga0466722_189659 | 3300042609 | Bacteria | 4545 |
| 77 | JGI24698J34947_10008872 | 3300002449 | Bacteria | 5519 |
| 78 | JGI24698J34947_10022401 | 3300002449 | Bacteria | 3389 |
| 79 | JGI24695J34938_10005448 | 3300002450 | Bacteria | 7929 |
| 80 | JGI24695J34938_10019317 | 3300002450 | Bacteria | 3381 |
| 81 | Ga0072940_1004918 | 3300005200 | Bacteria | 32026 |
| 82 | Ga0072940_1020928 | 3300005200 | Bacteria | 3472 |
| 83 | Ga0072941_1022982 | 3300005201 | Bacteria | 707 |
| 84 | Ga0074263_114727 | 3300005485 | Bacteria | 2800 |
| 85 | Ga0466704_167337 | 3300042643 | Bacteria | 117281 |
| 86 | Ga0466704_233337 | 3300042643 | Bacteria | 4157 |
| 87 | Ga0123353_10964020 | 3300010167 | Bacteria | 1152 |
| 88 | Ga0466728_144243 | 3300042620 | Bacteria | 10187 |
| 89 | Ga0466699_042681 | 3300042597 | Bacteria | 2652 |
| 90 | Ga0466699_127057 | 3300042597 | Unclassified | 1168 |
| 91 | Ga0466699_136625 | 3300042597 | Bacteria | 7726 |
| 92 | Ga0466699_247310 | 3300042597 | Bacteria | 2096 |
| 93 | Ga0466699_286994 | 3300042597 | Unclassified | 2496 |
| 94 | Ga0466700_287004 | 3300042600 | Bacteria | 1496 |
| 95 | Ga0466716_422590 | 3300042605 | Bacteria | 2128 |
| 96 | Ga0466720_042945 | 3300042607 | Bacteria | 11120 |
| 97 | AustNasuHG_c1009164 | 3300000089 | Bacteria | 3483 |
| 98 | JGI24698J34947_10014804 | 3300002449 | Bacteria | 4248 |
| 99 | JGI24695J34938_10006745 | 3300002450 | Bacteria | 6832 |
| 100 | JGI24695J34938_10011898 | 3300002450 | Bacteria | 4650 |
| 101 | Ga0072940_1031463 | 3300005200 | Bacteria | 2802 |
| 102 | Ga0072941_1012365 | 3300005201 | Bacteria | 14347 |
| 103 | Ga0072941_1210121 | 3300005201 | Bacteria | 2074 |
| 104 | Ga0466708_013823 | 3300042652 | Bacteria | 15268 |
| 105 | Ga0123356_13179677 | 3300010049 | Bacteria | 572 |
| 106 | Ga0466712_162820 | 3300042614 | Bacteria | 9684 |
| 107 | Ga0466712_228312 | 3300042614 | Bacteria | 11861 |
| 108 | Ga0466718_168376 | 3300042617 | Bacteria | 4320 |
| 109 | Ga0466694_209082 | 3300042594 | Bacteria | 7012 |
| 110 | Ga0466699_051298 | 3300042597 | Bacteria | 7531 |
| 111 | Ga0466699_148119 | 3300042597 | Bacteria | 7095 |
| 112 | Ga0466699_395568 | 3300042597 | Bacteria | 1549 |
| 113 | JGI24698J34947_10000501 | 3300002449 | Bacteria | 18414 |
| 114 | Ga0072940_1000040 | 3300005200 | Bacteria | 8281 |
| 115 | Ga0466704_108854 | 3300042643 | Bacteria | 24907 |
| 116 | Ga0123353_10295515 | 3300010167 | Bacteria | 2477 |
| 117 | Ga0123353_10463965 | 3300010167 | Bacteria | 1860 |
| 118 | Ga0466712_185040 | 3300042614 | Unclassified | 3436 |
| 119 | Ga0466712_275746 | 3300042614 | Bacteria | 1126 |
| 120 | Ga0264413_106339 | 3300024493 | Bacteria | 1045 |
| 121 | Ga0264413_110293 | 3300024493 | Bacteria | 13666 |
| 122 | Ga0466692_002352 | 3300042591 | Bacteria | 7304 |
| 123 | Ga0466692_042581 | 3300042591 | Bacteria | 2098 |
| 124 | Ga0466699_056782 | 3300042597 | Bacteria | 8294 |
| 125 | Ga0466699_301575 | 3300042597 | Bacteria | 8866 |
| 126 | Ga0466699_312868 | 3300042597 | Bacteria | 3400 |
| 127 | Ga0466720_008103 | 3300042607 | Unclassified | 2441 |
| 128 | Ga0466720_065866 | 3300042607 | Bacteria | 1708 |
| 129 | JGI24698J34947_10027483 | 3300002449 | Bacteria | 3018 |
| 130 | JGI24698J34947_10083168 | 3300002449 | Bacteria | 1494 |
| 131 | JGI24695J34938_10010130 | 3300002450 | Bacteria | 5191 |
| 132 | JGI24695J34938_10025501 | 3300002450 | Bacteria | 2825 |
| 133 | Ga0072941_1140061 | 3300005201 | Unclassified | 2269 |
| 134 | Ga0466727_000110 | 3300042655 | Bacteria | 11699 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02639 | DUF188 | Uncharacterized BCR, YaiI/YqxD family COG1671 | 19 | 138 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.