Protein Family IF04158

Metagenome Isolate
174 Members
61 Samples
155 Scaffolds
436.26 Avg Length

🧬 Representative Sequence

ID
3300024493|Ga0264413_103772|Ga0264413_1037727
Length
527 aa
Sequence
MFEKLTEKITDAFRFVTGKSSISEKNIEDAVEAIKMALLDADVNLRVVRRFVNSTIEEAKGEKVLRSVDPSQQFIKIVHDKLVSFLGDADPASRALKLRGPDVISAVLMLGLQGSGKTTSSAKLALRLKKEGRKPMLVACDLVRPAAMEQLAVLGSQIGIPVHKEEGAKDSVKVYQNALSWANQNMIDTMIIDTTGRLQIDEPMMQELSRLKDAAKPDEMLLVADSMTGQAAADIAKTFDEKIGLTGVVLTKFDSDTRGGAALSLKTVTGKPLKFTGTGEKPEDFEPFHPDRLAGRILGMGDVVSLVEKAQEVINEKEALELQKKMEKENFTLEDWLSQLRAVKKMGSLQKMLEMIPGMQGQINEEDINKEELKHQEAILSSMTRKERANHLIIGPPRRSRIARGSGTSVAEVARLLKKFEKMRGMMKXHFVLFYPIDNFIDLAEDKACDGIGAAVVNRDFACVLVNKRGDGECYVRNVSGQFVNFTRVNYVRTRTRYYFPRLVNVKQGGAERINKTVTACKHSVVE

πŸ“Š Sample Types

Isolate 10.9%
Metagenome 89.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 33.3%
Unclassified 30.0%
Kalotermitidae 25.0%
Termopsidae 5.0%
Rhinotermitidae 3.3%
Blaberidae 1.7%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 156
Eukaryota 0
Viruses 0
Unclassified 18

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
2 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
3 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
4 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
5 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
6 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
7 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
8 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
9 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
16 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
17 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
18 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
19 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
24 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
25 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
26 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
27 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
28 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
29 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
30 2772190975 Treponema sp. RmG30 Isolate Blaberidae
31 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
32 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
33 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
34 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
35 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
36 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
37 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
38 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
39 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
40 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 2820142992 Unclassified Proteobacteria Emb289P3bin113 Isolate Unclassified
43 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
44 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
48 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
49 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
50 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
51 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
52 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
53 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
54 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
55 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
56 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
57 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
58 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
59 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
60 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
61 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_060591 3300042590 Bacteria 7889
2 Ga0466690_333748 3300042590 Bacteria 2299
3 Ga0466691_010908 3300042593 Bacteria 139266
4 Ga0466691_037124 3300042593 Bacteria 15978
5 Ga0466691_097940 3300042593 Bacteria 12799
6 Ga0466696_116902 3300042596 Bacteria 91607
7 Ga0466699_154656 3300042597 Bacteria 11689
8 Ga0466699_245995 3300042597 Unclassified 3262
9 Ga0466715_142625 3300042616 Bacteria 21529
10 Ga0466723_056519 3300042618 Unclassified 6190
11 Ga0466726_307308 3300042619 Bacteria 7425
12 Ga0123356_10092185 3300010049 Bacteria 2889
13 Ga0466706_247697 3300042599 Bacteria 2380
14 Ga0466722_076177 3300042609 Bacteria 29982
15 Ga0466731_007728 3300042622 Bacteria 2201
16 Ga0466735_001415 3300042624 Bacteria 8409
17 Ga0466704_118806 3300042643 Bacteria 5280
18 Ga0466704_128230 3300042643 Bacteria 41528
19 Ga0466705_078763 3300042612 Bacteria 55629
20 Ga0264413_105193 3300024493 Bacteria 48930
21 Ga0466657_095660 3300042582 Bacteria 23452
22 Ga0466694_207285 3300042594 Bacteria 1528
23 Ga0466696_191503 3300042596 Bacteria 28288
24 Ga0466699_300759 3300042597 Unclassified 7050
25 Ga0466712_090145 3300042614 Bacteria 11614
26 Ga0466715_486601 3300042616 Unclassified 4166
27 Ga0466723_015264 3300042618 Bacteria 20872
28 Ga0466723_029624 3300042618 Bacteria 5456
29 Ga0123356_10004228 3300010049 Bacteria 14850
30 Ga0123356_10013594 3300010049 Unclassified 7847
31 JGI24695J34938_10001109 3300002450 Bacteria 24296
32 JGI24695J34938_10001520 3300002450 Bacteria 19548
33 JGI24695J34938_10013491 3300002450 Bacteria 4289
34 Ga0466707_218734 3300042601 Bacteria 20681
35 Ga0466720_163349 3300042607 Bacteria 9865
36 Ga0466704_210643 3300042643 Bacteria 2995
37 Ga0466704_305893 3300042643 Bacteria 25055
38 Ga0466704_578777 3300042643 Bacteria 40746
39 Ga0466727_288643 3300042655 Bacteria 4885
40 Ga0415639_026009 3300038395 Bacteria 1674
41 Ga0466690_022221 3300042590 Bacteria 12516
42 Ga0466694_358738 3300042594 Bacteria 5162
43 Ga0466699_401445 3300042597 Bacteria 12931
44 Ga0466711_027821 3300042615 Bacteria 32058
45 Ga0466711_414791 3300042615 Bacteria 10745
46 Ga0466728_045214 3300042620 Bacteria 13285
47 Ga0123356_10071668 3300010049 Bacteria 3253
48 AustNasuHG_c1022489 3300000089 Bacteria 2025
49 JGI24695J34938_10000964 3300002450 Bacteria 26239
50 Ga0466706_157211 3300042599 Bacteria 3802
51 Ga0466719_023565 3300042606 Bacteria 7205
52 Ga0466719_354603 3300042606 Bacteria 18280
53 Ga0466722_177094 3300042609 Bacteria 7534
54 Ga0466722_215340 3300042609 Bacteria 21945
55 Ga0466703_004769 3300042636 Bacteria 8521
56 Ga0466708_466672 3300042652 Bacteria 38602
57 Ga0466705_108183 3300042612 Bacteria 8920
58 Ga0466692_024187 3300042591 Bacteria 27189
59 Ga0466715_039871 3300042616 Bacteria 33977
60 Ga0466715_394762 3300042616 Bacteria 38358
61 Ga0466715_588852 3300042616 Bacteria 7432
62 Ga0466723_191897 3300042618 Bacteria 3622
63 Ga0466726_079612 3300042619 Bacteria 1703
64 Ga0123356_10032247 3300010049 Bacteria 4902
65 Ga0123356_10096993 3300010049 Unclassified 2820
66 Ga0123354_10136902 3300010882 Bacteria 3056
67 AustNasuHG_c1001075 3300000089 Bacteria 9822
68 AustNasuHG_c1004949 3300000089 Bacteria 4766
69 JGI24695J34938_10000581 3300002450 Bacteria 35281
70 JGI24695J34938_10019334 3300002450 Bacteria 3379
71 Ga0466716_179886 3300042605 Bacteria 19041
72 Ga0466720_033724 3300042607 Bacteria 8840
73 Ga0466722_218056 3300042609 Bacteria 3052
74 Ga0466703_054134 3300042636 Bacteria 22697
75 Ga0466704_148730 3300042643 Bacteria 7961
76 Ga0466709_196026 3300042648 Bacteria 5504
77 Ga0466705_126761 3300042612 Bacteria 31942
78 Ga0466711_347398 3300042615 Bacteria 2653
79 Ga0466715_130758 3300042616 Unclassified 2304
80 Ga0466715_518326 3300042616 Unclassified 4110
81 Ga0466726_495932 3300042619 Bacteria 22229
82 Ga0123356_10000488 3300010049 Bacteria 44166
83 Ga0123356_10030797 3300010049 Unclassified 5020
84 Ga0123353_10214401 3300010167 Bacteria 3017
85 JGI24698J34947_10007746 3300002449 Bacteria 5901
86 Ga0074263_110213 3300005485 Unclassified 3202
87 Ga0466700_210165 3300042600 Bacteria 3702
88 Ga0466719_220651 3300042606 Bacteria 8059
89 Ga0466704_019245 3300042643 Bacteria 5002
90 Ga0466704_391063 3300042643 Bacteria 3408
91 Ga0466708_027170 3300042652 Bacteria 1785
92 Ga0466708_096365 3300042652 Bacteria 19029
93 Ga0466727_284695 3300042655 Bacteria 2643
94 Ga0466705_085472 3300042612 Unclassified 1477
95 Ga0466705_105065 3300042612 Bacteria 19900
96 Ga0466694_179316 3300042594 Bacteria 7133
97 Ga0466699_434667 3300042597 Unclassified 2111
98 Ga0466715_065687 3300042616 Bacteria 3581
99 Ga0466723_117599 3300042618 Bacteria 7954
100 Ga0466716_216137 3300042605 Bacteria 4457
101 Ga0466716_311153 3300042605 Bacteria 20308
102 Ga0466719_016747 3300042606 Bacteria 5759
103 Ga0466720_177676 3300042607 Bacteria 91443
104 Ga0466722_072637 3300042609 Bacteria 8065
105 Ga0466722_180419 3300042609 Bacteria 9896
106 Ga0466722_194007 3300042609 Bacteria 6135
107 Ga0466704_195348 3300042643 Bacteria 13077
108 Ga0466704_408972 3300042643 Bacteria 12038
109 Ga0466708_188080 3300042652 Unclassified 6223
110 Ga0466705_167337 3300042612 Unclassified 1477
111 Ga0466692_084841 3300042591 Bacteria 12847
112 Ga0466693_244531 3300042592 Bacteria 3216
113 Ga0466694_268649 3300042594 Bacteria 30529
114 Ga0466696_389216 3300042596 Bacteria 1816
115 Ga0466712_023799 3300042614 Bacteria 49566
116 Ga0466711_044755 3300042615 Bacteria 11171
117 Ga0466718_081136 3300042617 Bacteria 2943
118 Ga0466723_212537 3300042618 Bacteria 9854
119 Ga0466728_295496 3300042620 Bacteria 96280
120 JGI24695J34938_10000878 3300002450 Bacteria 27738
121 JGI24705J35276_12228487 3300002504 Bacteria 3194
122 Ga0072940_1000897 3300005200 Bacteria 20293
123 Ga0466706_165313 3300042599 Bacteria 60368
124 Ga0466719_041805 3300042606 Bacteria 4419
125 Ga0466719_090346 3300042606 Bacteria 25819
126 Ga0466720_015605 3300042607 Unclassified 4095
127 Ga0466721_191339 3300042608 Bacteria 79638
128 Ga0466703_160544 3300042636 Unclassified 5416
129 Ga0466709_125917 3300042648 Unclassified 4137
130 Ga0466708_240405 3300042652 Bacteria 15347
131 Ga0466705_063324 3300042612 Bacteria 6247
132 Ga0264413_103772 3300024493 Bacteria 6915
133 Ga0466692_157495 3300042591 Bacteria 6333
134 Ga0466691_093375 3300042593 Bacteria 1823
135 Ga0466691_102438 3300042593 Bacteria 7246
136 Ga0466696_288483 3300042596 Bacteria 26421
137 Ga0466696_461655 3300042596 Bacteria 6080
138 Ga0466699_006896 3300042597 Bacteria 13409
139 Ga0466699_229425 3300042597 Bacteria 4525
140 Ga0466699_423178 3300042597 Bacteria 6842
141 Ga0466712_205514 3300042614 Bacteria 2409
142 Ga0466711_303614 3300042615 Bacteria 16027
143 Ga0466711_364049 3300042615 Bacteria 29051
144 Ga0466715_593879 3300042616 Bacteria 26438
145 Ga0123356_10000943 3300010049 Bacteria 32172
146 Ga0123356_10014765 3300010049 Bacteria 7502
147 Ga0123356_10016195 3300010049 Bacteria 7121
148 AustNasuHG_c1002489 3300000089 Bacteria 6671
149 JGI24698J34947_10021165 3300002449 Unclassified 3502
150 Ga0466716_269189 3300042605 Bacteria 5167
151 Ga0466719_416844 3300042606 Bacteria 2612
152 Ga0466722_169490 3300042609 Bacteria 5633
153 Ga0466709_291922 3300042648 Bacteria 5385
154 Ga0466727_149586 3300042655 Bacteria 2734
155 Ga0466727_178267 3300042655 Bacteria 5306

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00448 SRP54 SRP54-type protein, GTPase domain 106 299 0.99
PF02881 SRP54_N SRP54-type protein, helical bundle domain 5 82 0.95
PF02978 SRP_SPB Signal peptide binding domain 330 427 0.92
PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain 114 258 0.91

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.