Protein Family IF04158
Metagenome
Isolate
174
Members
61
Samples
155
Scaffolds
436.26
Avg Length
Representative Sequence
- ID
- 3300024493|Ga0264413_103772|Ga0264413_1037727
- Length
- 527 aa
- Sequence
- MFEKLTEKITDAFRFVTGKSSISEKNIEDAVEAIKMALLDADVNLRVVRRFVNSTIEEAKGEKVLRSVDPSQQFIKIVHDKLVSFLGDADPASRALKLRGPDVISAVLMLGLQGSGKTTSSAKLALRLKKEGRKPMLVACDLVRPAAMEQLAVLGSQIGIPVHKEEGAKDSVKVYQNALSWANQNMIDTMIIDTTGRLQIDEPMMQELSRLKDAAKPDEMLLVADSMTGQAAADIAKTFDEKIGLTGVVLTKFDSDTRGGAALSLKTVTGKPLKFTGTGEKPEDFEPFHPDRLAGRILGMGDVVSLVEKAQEVINEKEALELQKKMEKENFTLEDWLSQLRAVKKMGSLQKMLEMIPGMQGQINEEDINKEELKHQEAILSSMTRKERANHLIIGPPRRSRIARGSGTSVAEVARLLKKFEKMRGMMKXHFVLFYPIDNFIDLAEDKACDGIGAAVVNRDFACVLVNKRGDGECYVRNVSGQFVNFTRVNYVRTRTRYYFPRLVNVKQGGAERINKTVTACKHSVVE
Sample Types
Isolate
10.9%
Metagenome
89.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Unclassified
30.0%
Kalotermitidae
25.0%
Termopsidae
5.0%
Rhinotermitidae
3.3%
Blaberidae
1.7%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
156
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 4 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 5 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 6 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 7 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 8 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 16 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 17 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 18 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 19 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 20 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 21 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 22 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 23 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 24 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 25 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 26 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 27 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 30 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 31 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 32 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 33 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 34 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 35 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 36 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 37 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 38 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 2820142992 | Unclassified Proteobacteria Emb289P3bin113 | Isolate | Unclassified |
| 43 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 44 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 49 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 50 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 51 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 52 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 53 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 54 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 55 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 56 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 57 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 58 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 59 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 60 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 61 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_060591 | 3300042590 | Bacteria | 7889 |
| 2 | Ga0466690_333748 | 3300042590 | Bacteria | 2299 |
| 3 | Ga0466691_010908 | 3300042593 | Bacteria | 139266 |
| 4 | Ga0466691_037124 | 3300042593 | Bacteria | 15978 |
| 5 | Ga0466691_097940 | 3300042593 | Bacteria | 12799 |
| 6 | Ga0466696_116902 | 3300042596 | Bacteria | 91607 |
| 7 | Ga0466699_154656 | 3300042597 | Bacteria | 11689 |
| 8 | Ga0466699_245995 | 3300042597 | Unclassified | 3262 |
| 9 | Ga0466715_142625 | 3300042616 | Bacteria | 21529 |
| 10 | Ga0466723_056519 | 3300042618 | Unclassified | 6190 |
| 11 | Ga0466726_307308 | 3300042619 | Bacteria | 7425 |
| 12 | Ga0123356_10092185 | 3300010049 | Bacteria | 2889 |
| 13 | Ga0466706_247697 | 3300042599 | Bacteria | 2380 |
| 14 | Ga0466722_076177 | 3300042609 | Bacteria | 29982 |
| 15 | Ga0466731_007728 | 3300042622 | Bacteria | 2201 |
| 16 | Ga0466735_001415 | 3300042624 | Bacteria | 8409 |
| 17 | Ga0466704_118806 | 3300042643 | Bacteria | 5280 |
| 18 | Ga0466704_128230 | 3300042643 | Bacteria | 41528 |
| 19 | Ga0466705_078763 | 3300042612 | Bacteria | 55629 |
| 20 | Ga0264413_105193 | 3300024493 | Bacteria | 48930 |
| 21 | Ga0466657_095660 | 3300042582 | Bacteria | 23452 |
| 22 | Ga0466694_207285 | 3300042594 | Bacteria | 1528 |
| 23 | Ga0466696_191503 | 3300042596 | Bacteria | 28288 |
| 24 | Ga0466699_300759 | 3300042597 | Unclassified | 7050 |
| 25 | Ga0466712_090145 | 3300042614 | Bacteria | 11614 |
| 26 | Ga0466715_486601 | 3300042616 | Unclassified | 4166 |
| 27 | Ga0466723_015264 | 3300042618 | Bacteria | 20872 |
| 28 | Ga0466723_029624 | 3300042618 | Bacteria | 5456 |
| 29 | Ga0123356_10004228 | 3300010049 | Bacteria | 14850 |
| 30 | Ga0123356_10013594 | 3300010049 | Unclassified | 7847 |
| 31 | JGI24695J34938_10001109 | 3300002450 | Bacteria | 24296 |
| 32 | JGI24695J34938_10001520 | 3300002450 | Bacteria | 19548 |
| 33 | JGI24695J34938_10013491 | 3300002450 | Bacteria | 4289 |
| 34 | Ga0466707_218734 | 3300042601 | Bacteria | 20681 |
| 35 | Ga0466720_163349 | 3300042607 | Bacteria | 9865 |
| 36 | Ga0466704_210643 | 3300042643 | Bacteria | 2995 |
| 37 | Ga0466704_305893 | 3300042643 | Bacteria | 25055 |
| 38 | Ga0466704_578777 | 3300042643 | Bacteria | 40746 |
| 39 | Ga0466727_288643 | 3300042655 | Bacteria | 4885 |
| 40 | Ga0415639_026009 | 3300038395 | Bacteria | 1674 |
| 41 | Ga0466690_022221 | 3300042590 | Bacteria | 12516 |
| 42 | Ga0466694_358738 | 3300042594 | Bacteria | 5162 |
| 43 | Ga0466699_401445 | 3300042597 | Bacteria | 12931 |
| 44 | Ga0466711_027821 | 3300042615 | Bacteria | 32058 |
| 45 | Ga0466711_414791 | 3300042615 | Bacteria | 10745 |
| 46 | Ga0466728_045214 | 3300042620 | Bacteria | 13285 |
| 47 | Ga0123356_10071668 | 3300010049 | Bacteria | 3253 |
| 48 | AustNasuHG_c1022489 | 3300000089 | Bacteria | 2025 |
| 49 | JGI24695J34938_10000964 | 3300002450 | Bacteria | 26239 |
| 50 | Ga0466706_157211 | 3300042599 | Bacteria | 3802 |
| 51 | Ga0466719_023565 | 3300042606 | Bacteria | 7205 |
| 52 | Ga0466719_354603 | 3300042606 | Bacteria | 18280 |
| 53 | Ga0466722_177094 | 3300042609 | Bacteria | 7534 |
| 54 | Ga0466722_215340 | 3300042609 | Bacteria | 21945 |
| 55 | Ga0466703_004769 | 3300042636 | Bacteria | 8521 |
| 56 | Ga0466708_466672 | 3300042652 | Bacteria | 38602 |
| 57 | Ga0466705_108183 | 3300042612 | Bacteria | 8920 |
| 58 | Ga0466692_024187 | 3300042591 | Bacteria | 27189 |
| 59 | Ga0466715_039871 | 3300042616 | Bacteria | 33977 |
| 60 | Ga0466715_394762 | 3300042616 | Bacteria | 38358 |
| 61 | Ga0466715_588852 | 3300042616 | Bacteria | 7432 |
| 62 | Ga0466723_191897 | 3300042618 | Bacteria | 3622 |
| 63 | Ga0466726_079612 | 3300042619 | Bacteria | 1703 |
| 64 | Ga0123356_10032247 | 3300010049 | Bacteria | 4902 |
| 65 | Ga0123356_10096993 | 3300010049 | Unclassified | 2820 |
| 66 | Ga0123354_10136902 | 3300010882 | Bacteria | 3056 |
| 67 | AustNasuHG_c1001075 | 3300000089 | Bacteria | 9822 |
| 68 | AustNasuHG_c1004949 | 3300000089 | Bacteria | 4766 |
| 69 | JGI24695J34938_10000581 | 3300002450 | Bacteria | 35281 |
| 70 | JGI24695J34938_10019334 | 3300002450 | Bacteria | 3379 |
| 71 | Ga0466716_179886 | 3300042605 | Bacteria | 19041 |
| 72 | Ga0466720_033724 | 3300042607 | Bacteria | 8840 |
| 73 | Ga0466722_218056 | 3300042609 | Bacteria | 3052 |
| 74 | Ga0466703_054134 | 3300042636 | Bacteria | 22697 |
| 75 | Ga0466704_148730 | 3300042643 | Bacteria | 7961 |
| 76 | Ga0466709_196026 | 3300042648 | Bacteria | 5504 |
| 77 | Ga0466705_126761 | 3300042612 | Bacteria | 31942 |
| 78 | Ga0466711_347398 | 3300042615 | Bacteria | 2653 |
| 79 | Ga0466715_130758 | 3300042616 | Unclassified | 2304 |
| 80 | Ga0466715_518326 | 3300042616 | Unclassified | 4110 |
| 81 | Ga0466726_495932 | 3300042619 | Bacteria | 22229 |
| 82 | Ga0123356_10000488 | 3300010049 | Bacteria | 44166 |
| 83 | Ga0123356_10030797 | 3300010049 | Unclassified | 5020 |
| 84 | Ga0123353_10214401 | 3300010167 | Bacteria | 3017 |
| 85 | JGI24698J34947_10007746 | 3300002449 | Bacteria | 5901 |
| 86 | Ga0074263_110213 | 3300005485 | Unclassified | 3202 |
| 87 | Ga0466700_210165 | 3300042600 | Bacteria | 3702 |
| 88 | Ga0466719_220651 | 3300042606 | Bacteria | 8059 |
| 89 | Ga0466704_019245 | 3300042643 | Bacteria | 5002 |
| 90 | Ga0466704_391063 | 3300042643 | Bacteria | 3408 |
| 91 | Ga0466708_027170 | 3300042652 | Bacteria | 1785 |
| 92 | Ga0466708_096365 | 3300042652 | Bacteria | 19029 |
| 93 | Ga0466727_284695 | 3300042655 | Bacteria | 2643 |
| 94 | Ga0466705_085472 | 3300042612 | Unclassified | 1477 |
| 95 | Ga0466705_105065 | 3300042612 | Bacteria | 19900 |
| 96 | Ga0466694_179316 | 3300042594 | Bacteria | 7133 |
| 97 | Ga0466699_434667 | 3300042597 | Unclassified | 2111 |
| 98 | Ga0466715_065687 | 3300042616 | Bacteria | 3581 |
| 99 | Ga0466723_117599 | 3300042618 | Bacteria | 7954 |
| 100 | Ga0466716_216137 | 3300042605 | Bacteria | 4457 |
| 101 | Ga0466716_311153 | 3300042605 | Bacteria | 20308 |
| 102 | Ga0466719_016747 | 3300042606 | Bacteria | 5759 |
| 103 | Ga0466720_177676 | 3300042607 | Bacteria | 91443 |
| 104 | Ga0466722_072637 | 3300042609 | Bacteria | 8065 |
| 105 | Ga0466722_180419 | 3300042609 | Bacteria | 9896 |
| 106 | Ga0466722_194007 | 3300042609 | Bacteria | 6135 |
| 107 | Ga0466704_195348 | 3300042643 | Bacteria | 13077 |
| 108 | Ga0466704_408972 | 3300042643 | Bacteria | 12038 |
| 109 | Ga0466708_188080 | 3300042652 | Unclassified | 6223 |
| 110 | Ga0466705_167337 | 3300042612 | Unclassified | 1477 |
| 111 | Ga0466692_084841 | 3300042591 | Bacteria | 12847 |
| 112 | Ga0466693_244531 | 3300042592 | Bacteria | 3216 |
| 113 | Ga0466694_268649 | 3300042594 | Bacteria | 30529 |
| 114 | Ga0466696_389216 | 3300042596 | Bacteria | 1816 |
| 115 | Ga0466712_023799 | 3300042614 | Bacteria | 49566 |
| 116 | Ga0466711_044755 | 3300042615 | Bacteria | 11171 |
| 117 | Ga0466718_081136 | 3300042617 | Bacteria | 2943 |
| 118 | Ga0466723_212537 | 3300042618 | Bacteria | 9854 |
| 119 | Ga0466728_295496 | 3300042620 | Bacteria | 96280 |
| 120 | JGI24695J34938_10000878 | 3300002450 | Bacteria | 27738 |
| 121 | JGI24705J35276_12228487 | 3300002504 | Bacteria | 3194 |
| 122 | Ga0072940_1000897 | 3300005200 | Bacteria | 20293 |
| 123 | Ga0466706_165313 | 3300042599 | Bacteria | 60368 |
| 124 | Ga0466719_041805 | 3300042606 | Bacteria | 4419 |
| 125 | Ga0466719_090346 | 3300042606 | Bacteria | 25819 |
| 126 | Ga0466720_015605 | 3300042607 | Unclassified | 4095 |
| 127 | Ga0466721_191339 | 3300042608 | Bacteria | 79638 |
| 128 | Ga0466703_160544 | 3300042636 | Unclassified | 5416 |
| 129 | Ga0466709_125917 | 3300042648 | Unclassified | 4137 |
| 130 | Ga0466708_240405 | 3300042652 | Bacteria | 15347 |
| 131 | Ga0466705_063324 | 3300042612 | Bacteria | 6247 |
| 132 | Ga0264413_103772 | 3300024493 | Bacteria | 6915 |
| 133 | Ga0466692_157495 | 3300042591 | Bacteria | 6333 |
| 134 | Ga0466691_093375 | 3300042593 | Bacteria | 1823 |
| 135 | Ga0466691_102438 | 3300042593 | Bacteria | 7246 |
| 136 | Ga0466696_288483 | 3300042596 | Bacteria | 26421 |
| 137 | Ga0466696_461655 | 3300042596 | Bacteria | 6080 |
| 138 | Ga0466699_006896 | 3300042597 | Bacteria | 13409 |
| 139 | Ga0466699_229425 | 3300042597 | Bacteria | 4525 |
| 140 | Ga0466699_423178 | 3300042597 | Bacteria | 6842 |
| 141 | Ga0466712_205514 | 3300042614 | Bacteria | 2409 |
| 142 | Ga0466711_303614 | 3300042615 | Bacteria | 16027 |
| 143 | Ga0466711_364049 | 3300042615 | Bacteria | 29051 |
| 144 | Ga0466715_593879 | 3300042616 | Bacteria | 26438 |
| 145 | Ga0123356_10000943 | 3300010049 | Bacteria | 32172 |
| 146 | Ga0123356_10014765 | 3300010049 | Bacteria | 7502 |
| 147 | Ga0123356_10016195 | 3300010049 | Bacteria | 7121 |
| 148 | AustNasuHG_c1002489 | 3300000089 | Bacteria | 6671 |
| 149 | JGI24698J34947_10021165 | 3300002449 | Unclassified | 3502 |
| 150 | Ga0466716_269189 | 3300042605 | Bacteria | 5167 |
| 151 | Ga0466719_416844 | 3300042606 | Bacteria | 2612 |
| 152 | Ga0466722_169490 | 3300042609 | Bacteria | 5633 |
| 153 | Ga0466709_291922 | 3300042648 | Bacteria | 5385 |
| 154 | Ga0466727_149586 | 3300042655 | Bacteria | 2734 |
| 155 | Ga0466727_178267 | 3300042655 | Bacteria | 5306 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.