Protein Family IF04146

Metagenome Metatranscriptome Isolate
138 Members
47 Samples
133 Scaffolds
153.71 Avg Length

🧬 Representative Sequence

ID
3300021239|Ga0223677_1012571|Ga0223677_10125711
Length
185 aa
Sequence
MKRIIIEQDKCDGCKNCSIACMQAHREPSAEPVGRGSPPVLTVTGSRGTVYDLDLLDPKNEARHTITNYRKGGYVPVFCRHCAVPDCVGACMSGALKKDPATGHVQYDEKRCGTCFMCVMSCPYGNIKPDSVTRTKILKCDFCRGHSGPDDNEEPNCVKFCPKDAIHVEEVDAGVEAEEEVSITI

📊 Sample Types

Isolate 3.6%
Metagenome 95.7%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.4%
Kalotermitidae 31.1%
Unclassified 11.1%
Rhinotermitidae 6.7%
Termopsidae 6.7%

🌳 Taxonomy

Archaea 1
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
9 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
10 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
11 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
12 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
17 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
18 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
19 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
22 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
23 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
24 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
25 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
26 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
31 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
32 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
35 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
36 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
37 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
38 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
39 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
40 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
41 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
42 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
43 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
44 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
45 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_357245 3300042601 Bacteria 2324
2 Ga0466719_103338 3300042606 Bacteria 3764
3 Ga0466735_197205 3300042624 Bacteria 1940
4 Ga0466709_345435 3300042648 Bacteria 3928
5 Ga0466708_026867 3300042652 Bacteria 3048
6 Ga0123356_10017549 3300010049 Bacteria 6809
7 JGI24698J34947_10000859 3300002449 Bacteria 15300
8 JGI24698J34947_10066472 3300002449 Bacteria 1754
9 Ga0466711_008042 3300042615 Bacteria 6791
10 Ga0466715_625287 3300042616 Unclassified 4581
11 Ga0466718_061054 3300042617 Bacteria 2058
12 Ga0466707_241063 3300042601 Bacteria 1185
13 Ga0466720_067387 3300042607 Bacteria 1448
14 Ga0466720_176780 3300042607 Bacteria 1139
15 Ga0466703_025735 3300042636 Bacteria 4851
16 Ga0466708_009706 3300042652 Bacteria 37452
17 Ga0466727_255317 3300042655 Bacteria 1156
18 Ga0466727_285868 3300042655 Bacteria 4403
19 Ga0466690_137434 3300042590 Bacteria 1231
20 Ga0466692_077445 3300042591 Bacteria 15710
21 Ga0466699_111398 3300042597 Bacteria 1040
22 JGI24698J34947_10272702 3300002449 Unclassified 622
23 Ga0466712_254077 3300042614 Bacteria 5987
24 Ga0466723_059997 3300042618 Bacteria 10844
25 Ga0466726_050457 3300042619 Bacteria 1215
26 Ga0466727_352159 3300042655 Bacteria 1191
27 Ga0466700_068786 3300042600 Bacteria 1043
28 Ga0466700_490118 3300042600 Bacteria 1497
29 Ga0466707_204542 3300042601 Bacteria 1172
30 Ga0466719_280190 3300042606 Bacteria 7440
31 Ga0466698_222550 3300042610 Bacteria 1079
32 Ga0466727_310418 3300042655 Bacteria 6192
33 Ga0123356_10053930 3300010049 Unclassified 3743
34 Ga0123356_10189434 3300010049 Bacteria 2086
35 Ga0123356_11246693 3300010049 Unclassified 908
36 Ga0123356_12089618 3300010049 Bacteria 707
37 Ga0264413_136870 3300024493 Bacteria 1529
38 Ga0466691_122347 3300042593 Bacteria 1220
39 JGI24702J35022_10487368 3300002462 Bacteria 755
40 Ga0466712_043705 3300042614 Unclassified 2632
41 Ga0466700_102360 3300042600 Bacteria 2222
42 Ga0466700_120687 3300042600 Bacteria 1120
43 Ga0466719_168888 3300042606 Bacteria 8834
44 Ga0466720_057213 3300042607 Bacteria 5982
45 Ga0466720_113969 3300042607 Unclassified 1695
46 Ga0466722_027937 3300042609 Bacteria 29446
47 Ga0466709_135527 3300042648 Bacteria 31176
48 Ga0466727_149289 3300042655 Unclassified 1364
49 Ga0123356_10649552 3300010049 Bacteria 1222
50 Ga0123353_10709842 3300010167 Unclassified 1409
51 Ga0466691_090740 3300042593 Bacteria 11432
52 Ga0466694_160323 3300042594 Bacteria 18148
53 JGI24698J34947_10083290 3300002449 Archaea 1493
54 Ga0466711_147997 3300042615 Bacteria 10898
55 Ga0466718_134310 3300042617 Bacteria 1412
56 Ga0466723_036683 3300042618 Bacteria 5300
57 Ga0466728_083324 3300042620 Bacteria 6334
58 Ga0466729_032016 3300042621 Bacteria 2193
59 Ga0466705_104349 3300042612 Bacteria 3677
60 Ga0466700_327442 3300042600 Bacteria 1003
61 Ga0466719_018979 3300042606 Bacteria 2995
62 Ga0123355_10000565 3300009826 Bacteria 49809
63 Ga0123356_10121276 3300010049 Bacteria 2543
64 Ga0466690_147906 3300042590 Bacteria 4865
65 Ga0466690_207003 3300042590 Unclassified 1486
66 Ga0466694_272890 3300042594 Bacteria 3025
67 Ga0466694_318162 3300042594 Bacteria 1287
68 JGI24698J34947_10000608 3300002449 Bacteria 17177
69 JGI24698J34947_10027665 3300002449 Unclassified 3007
70 JGI24698J34947_10132899 3300002449 Bacteria 1060
71 JGI24700J35501_10930379 3300002508 Bacteria 13486
72 Ga0074263_114566 3300005485 Unclassified 916
73 Ga0466715_392245 3300042616 Bacteria 49927
74 Ga0466718_100218 3300042617 Bacteria 2097
75 Ga0466726_139677 3300042619 Bacteria 2474
76 Ga0466726_143146 3300042619 Bacteria 5488
77 Ga0466726_401633 3300042619 Bacteria 1274
78 Ga0466705_032358 3300042612 Bacteria 3952
79 Ga0466707_093315 3300042601 Bacteria 1762
80 Ga0466716_068024 3300042605 Bacteria 3929
81 Ga0466720_015192 3300042607 Unclassified 1593
82 Ga0466720_200453 3300042607 Bacteria 3191
83 Ga0466703_210898 3300042636 Bacteria 1891
84 Ga0466704_142060 3300042643 Bacteria 2821
85 Ga0466708_138370 3300042652 Bacteria 2993
86 Ga0123356_10442020 3300010049 Bacteria 1447
87 Ga0466691_030467 3300042593 Unclassified 8725
88 Ga0466694_228658 3300042594 Bacteria 1233
89 Ga0466694_265695 3300042594 Bacteria 1274
90 Ga0466696_111243 3300042596 Bacteria 20801
91 Ga0466696_157918 3300042596 Bacteria 3333
92 AustNasuHG_c1003672 3300000089 Bacteria 5531
93 Ga0466711_488710 3300042615 Bacteria 35901
94 Ga0466715_343333 3300042616 Bacteria 16204
95 Ga0466718_047905 3300042617 Bacteria 1474
96 Ga0466716_035096 3300042605 Bacteria 8661
97 Ga0466716_356511 3300042605 Bacteria 7787
98 Ga0466719_408609 3300042606 Bacteria 1505
99 Ga0466703_064542 3300042636 Bacteria 6940
100 Ga0466709_379327 3300042648 Unclassified 2710
101 Ga0123355_10001992 3300009826 Bacteria 28838
102 Ga0123356_10762828 3300010049 Unclassified 1138
103 Ga0223677_1012571 3300021239 Bacteria 733
104 Ga0264413_131697 3300024493 Unclassified 7179
105 Ga0466694_213174 3300042594 Bacteria 2854
106 Ga0466696_204797 3300042596 Bacteria 4892
107 Ga0466699_000177 3300042597 Bacteria 1424
108 JGI24698J34947_10000285 3300002449 Bacteria 21879
109 JGI24698J34947_10000461 3300002449 Bacteria 18966
110 JGI24698J34947_10005828 3300002449 Bacteria 6753
111 JGI24698J34947_10006448 3300002449 Bacteria 6439
112 JGI24705J35276_11756393 3300002504 Bacteria 660
113 Ga0466705_406686 3300042612 Bacteria 3351
114 Ga0466712_053483 3300042614 Bacteria 1218
115 Ga0466723_315810 3300042618 Bacteria 5165
116 Ga0466726_264032 3300042619 Bacteria 1418
117 Ga0466717_069556 3300042604 Bacteria 1443
118 Ga0466722_037127 3300042609 Bacteria 4002
119 Ga0466703_153446 3300042636 Bacteria 2381
120 Ga0123355_10065361 3300009826 Bacteria 5858
121 Ga0415639_088020 3300038395 Bacteria 1808
122 Ga0466657_325704 3300042582 Bacteria 1458
123 Ga0466694_367051 3300042594 Bacteria 1414
124 Ga0466699_035652 3300042597 Bacteria 1602
125 Ga0466699_175866 3300042597 Unclassified 1803
126 AustNasuHG_c1000189 3300000089 Bacteria 20301
127 JGI24698J34947_10005086 3300002449 Unclassified 7203
128 JGI24698J34947_10033187 3300002449 Bacteria 2709
129 Ga0074263_107452 3300005485 Unclassified 1490
130 Ga0466712_136692 3300042614 Bacteria 1823
131 Ga0466718_081324 3300042617 Bacteria 1136
132 Ga0466718_124800 3300042617 Bacteria 1158
133 Ga0466726_444558 3300042619 Bacteria 4796

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009826 Ga0123355_10065361 Ga0123355_100653617 127
2 3300010049 Ga0123356_10189434 Ga0123356_101894342 127
3 3300042652 Ga0466708_009706 Ga0466708_009706_26754_27221 128
4 3300042590 Ga0466690_207003 Ga0466690_207003_1055_1444 129
5 3300042596 Ga0466696_157918 Ga0466696_157918_255_644 129
6 3300042655 Ga0466727_149289 Ga0466727_149289_934_1323 129
7 3300042655 Ga0466727_285868 Ga0466727_285868_68_469 133
8 3300042619 Ga0466726_143146 Ga0466726_143146_3736_4140 134
9 3300042612 Ga0466705_032358 Ga0466705_032358_2037_2444 135
10 3300042601 Ga0466707_093315 Ga0466707_093315_487_900 137
11 3300042606 Ga0466719_408609 Ga0466719_408609_404_871 138
12 3300042593 Ga0466691_030467 Ga0466691_030467_4542_5009 139
13 3300042590 Ga0466690_137434 Ga0466690_137434_330_797 140
14 3300042655 Ga0466727_352159 Ga0466727_352159_16_441 141
15 3300042605 Ga0466716_035096 Ga0466716_035096_6303_6743 146
16 3300042618 Ga0466723_315810 Ga0466723_315810_2119_2559 146
17 3300042648 Ga0466709_345435 Ga0466709_345435_1898_2338 146
18 3300010049 Ga0123356_10053930 Ga0123356_100539302 148
19 3300010049 Ga0123356_10442020 Ga0123356_104420202 148
20 3300010049 Ga0123356_10762828 Ga0123356_107628282 148
21 3300010049 Ga0123356_11246693 Ga0123356_112466932 148
22 3300010167 Ga0123353_10709842 Ga0123353_107098422 148
23 3300005485 Ga0074263_114566 Ga0074263_1145661 149
24 3300010049 Ga0123356_10017549 Ga0123356_100175492 149
25 3300010049 Ga0123356_12089618 Ga0123356_120896182 149
26 3300042591 Ga0466692_077445 Ga0466692_077445_6155_6604 149
27 3300042617 Ga0466718_061054 Ga0466718_061054_120_614 149
28 3300042636 Ga0466703_064542 Ga0466703_064542_1527_1976 149
29 iso_pr_bacteria 2590828841 2593260502 149
30 3300010049 Ga0123356_10649552 Ga0123356_106495522 150
31 3300042593 Ga0466691_090740 Ga0466691_090740_9945_10397 150
32 3300042593 Ga0466691_122347 Ga0466691_122347_712_1164 150
33 3300042594 Ga0466694_272890 Ga0466694_272890_791_1243 150
34 3300042606 Ga0466719_018979 Ga0466719_018979_2039_2491 150
35 3300042606 Ga0466719_103338 Ga0466719_103338_883_1335 150
36 3300042619 Ga0466726_139677 Ga0466726_139677_1965_2417 150
37 3300042624 Ga0466735_197205 Ga0466735_197205_352_804 150
38 3300042648 Ga0466709_379327 Ga0466709_379327_897_1349 150
39 3300042655 Ga0466727_310418 Ga0466727_310418_1242_1694 150
40 3300042601 Ga0466707_241063 Ga0466707_241063_676_1131 151
41 3300042601 Ga0466707_357245 Ga0466707_357245_1275_1730 151
42 3300042618 Ga0466723_059997 Ga0466723_059997_3385_3840 151
43 3300009826 Ga0123355_10000565 Ga0123355_1000056510 152
44 3300042607 Ga0466720_176780 Ga0466720_176780_488_985 152
45 3300042609 Ga0466722_027937 Ga0466722_027937_7726_8184 152
46 3300042615 Ga0466711_008042 Ga0466711_008042_4392_4850 152
47 3300038395 Ga0415639_088020 Ga0415639_088020_332_793 153
48 3300042605 Ga0466716_356511 Ga0466716_356511_5048_5509 153
49 3300042619 Ga0466726_401633 Ga0466726_401633_755_1216 153
50 3300042648 Ga0466709_135527 Ga0466709_135527_24675_25136 153
51 iso_pr_bacteria 2819994798 2819996618 153
52 3300002508 JGI24700J35501_10930379 JGI24700J35501_1093037910 154
53 3300024493 Ga0264413_131697 Ga0264413_1316974 154
54 3300042582 Ga0466657_325704 Ga0466657_325704_395_859 154
55 3300042590 Ga0466690_147906 Ga0466690_147906_2168_2632 154
56 3300042596 Ga0466696_111243 Ga0466696_111243_1879_2343 154
57 3300042600 Ga0466700_327442 Ga0466700_327442_498_962 154
58 3300042605 Ga0466716_068024 Ga0466716_068024_3072_3536 154
59 3300042606 Ga0466719_168888 Ga0466719_168888_8329_8793 154
60 3300042606 Ga0466719_280190 Ga0466719_280190_4123_4587 154
61 3300042609 Ga0466722_037127 Ga0466722_037127_2096_2560 154
62 3300042615 Ga0466711_147997 Ga0466711_147997_4549_5013 154
63 3300042616 Ga0466715_343333 Ga0466715_343333_2745_3209 154
64 3300042618 Ga0466723_036683 Ga0466723_036683_1125_1589 154
65 3300042619 Ga0466726_264032 Ga0466726_264032_824_1288 154
66 3300042620 Ga0466728_083324 Ga0466728_083324_3273_3737 154
67 3300042621 Ga0466729_032016 Ga0466729_032016_537_1001 154
68 3300042643 Ga0466704_142060 Ga0466704_142060_1618_2082 154
69 3300042652 Ga0466708_026867 Ga0466708_026867_1281_1745 154
70 3300042652 Ga0466708_138370 Ga0466708_138370_1264_1728 154
71 3300002462 JGI24702J35022_10487368 JGI24702J35022_104873682 155
72 3300042594 Ga0466694_265695 Ga0466694_265695_394_891 155
73 3300042600 Ga0466700_102360 Ga0466700_102360_517_984 155
74 3300042615 Ga0466711_488710 Ga0466711_488710_197_664 155
75 3300042616 Ga0466715_625287 Ga0466715_625287_1583_2050 155
76 3300042617 Ga0466718_124800 Ga0466718_124800_271_771 155
77 3300042619 Ga0466726_444558 Ga0466726_444558_3340_3807 155
78 3300042636 Ga0466703_025735 Ga0466703_025735_1855_2322 155
79 3300042636 Ga0466703_210898 Ga0466703_210898_392_859 155
80 iso_pr_bacteria 2781125655 2781317665 155
81 iso_pr_bacteria 650716099 650877993 155
82 3300005485 Ga0074263_107452 Ga0074263_1074522 156
83 3300009826 Ga0123355_10001992 Ga0123355_1000199221 156
84 3300042604 Ga0466717_069556 Ga0466717_069556_499_969 156
85 3300042607 Ga0466720_067387 Ga0466720_067387_746_1264 156
86 3300042655 Ga0466727_255317 Ga0466727_255317_194_664 156
87 3300002449 JGI24698J34947_10006448 JGI24698J34947_100064483 157
88 3300002504 JGI24705J35276_11756393 JGI24705J35276_117563931 157
89 3300042596 Ga0466696_204797 Ga0466696_204797_3394_3867 157
90 3300042600 Ga0466700_068786 Ga0466700_068786_517_990 157
91 3300042614 Ga0466712_136692 Ga0466712_136692_623_1096 157
92 3300042616 Ga0466715_392245 Ga0466715_392245_1909_2382 157
93 3300042619 Ga0466726_050457 Ga0466726_050457_174_647 157
94 3300042636 Ga0466703_153446 Ga0466703_153446_1255_1728 157
95 3300002449 JGI24698J34947_10000461 JGI24698J34947_100004619 158
96 3300002449 JGI24698J34947_10000608 JGI24698J34947_100006086 158
97 3300002449 JGI24698J34947_10005086 JGI24698J34947_100050862 158
98 3300002449 JGI24698J34947_10272702 JGI24698J34947_102727021 158
99 3300042597 Ga0466699_035652 Ga0466699_035652_661_1155 158
100 3300042597 Ga0466699_111398 Ga0466699_111398_455_931 158
101 3300042612 Ga0466705_104349 Ga0466705_104349_1702_2178 158
102 3300042614 Ga0466712_053483 Ga0466712_053483_192_668 158
103 3300002449 JGI24698J34947_10000859 JGI24698J34947_100008597 159
104 3300002449 JGI24698J34947_10083290 JGI24698J34947_100832902 159
105 3300042597 Ga0466699_175866 Ga0466699_175866_125_604 159
106 3300042617 Ga0466718_081324 Ga0466718_081324_134_613 159
107 3300042617 Ga0466718_134310 Ga0466718_134310_891_1370 159
108 3300042597 Ga0466699_000177 Ga0466699_000177_610_1092 160
109 3300042600 Ga0466700_490118 Ga0466700_490118_585_1067 160
110 3300042601 Ga0466707_204542 Ga0466707_204542_494_976 160
111 3300042607 Ga0466720_015192 Ga0466720_015192_1050_1532 160
112 3300042607 Ga0466720_057213 Ga0466720_057213_4426_4908 160
113 3300042607 Ga0466720_113969 Ga0466720_113969_391_873 160
114 3300042612 Ga0466705_406686 Ga0466705_406686_2171_2653 160
115 3300042614 Ga0466712_043705 Ga0466712_043705_1595_2077 160
116 3300042617 Ga0466718_047905 Ga0466718_047905_840_1322 160
117 3300000089 AustNasuHG_c1003672 AustNasuHG_10036724 161
118 3300002449 JGI24698J34947_10000285 JGI24698J34947_100002855 161
119 3300002449 JGI24698J34947_10005828 JGI24698J34947_100058283 161
120 3300002449 JGI24698J34947_10027665 JGI24698J34947_100276653 161
121 3300002449 JGI24698J34947_10033187 JGI24698J34947_100331872 161
122 3300002449 JGI24698J34947_10066472 JGI24698J34947_100664722 161
123 3300002449 JGI24698J34947_10132899 JGI24698J34947_101328992 161
124 3300042614 Ga0466712_254077 Ga0466712_254077_4469_4954 161
125 3300000089 AustNasuHG_c1000189 AustNasuHG_100018914 162
126 3300042594 Ga0466694_367051 Ga0466694_367051_597_1085 162
127 3300042600 Ga0466700_120687 Ga0466700_120687_456_977 163
128 3300042607 Ga0466720_200453 Ga0466720_200453_1975_2466 163
129 3300042617 Ga0466718_100218 Ga0466718_100218_832_1323 163
130 iso_pr_bacteria 2781125694 2781435408 163
131 3300042594 Ga0466694_228658 Ga0466694_228658_621_1115 164
132 3300042594 Ga0466694_213174 Ga0466694_213174_1786_2283 165
133 3300042610 Ga0466698_222550 Ga0466698_222550_188_685 165
134 3300042594 Ga0466694_160323 Ga0466694_160323_11975_12484 169
135 3300010049 Ga0123356_10121276 Ga0123356_101212762 172
136 3300024493 Ga0264413_136870 Ga0264413_1368702 174
137 3300042594 Ga0466694_318162 Ga0466694_318162_215_742 175
138 3300021239 Ga0223677_1012571 Ga0223677_10125711 185

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12838 Fer4_7 4Fe-4S dicluster domain 79 125 0.95
PF13187 Fer4_9 4Fe-4S dicluster domain 111 166 0.95
PF13237 Fer4_10 4Fe-4S dicluster domain 78 123 0.95
PF12837 Fer4_6 4Fe-4S binding domain 105 127 0.93
PF13247 Fer4_11 4Fe-4S dicluster domain 74 168 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.