Protein Family IF04141
Metagenome
Metatranscriptome
Isolate
146
Members
47
Samples
140
Scaffolds
103.08
Avg Length
Representative Sequence
- ID
- 3300021217|Ga0223687_124258|Ga0223687_1242582
- Length
- 103 aa
- Sequence
- MARKFSELRAKMSPERRARNEAAVKKALAEMPLNELRNARGLSQKMLADALHIQQPAIXSGLEKRADMYISTLRSHINAMGGELEVIARFPDGDVRISQFSQI
Sample Types
Isolate
4.1%
Metagenome
94.5%
MAG
0.0%
Metatranscriptome
1.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
62.2%
Unclassified
13.3%
Kalotermitidae
11.1%
Termopsidae
6.7%
Rhinotermitidae
4.4%
Noctuidae
2.2%
Taxonomy
Archaea
0
Bacteria
113
Eukaryota
0
Viruses
0
Unclassified
33
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 4 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 5 | 3300021217 | Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA | Metatranscriptome | Termitidae |
| 6 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 23 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 24 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 25 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 26 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 33 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 34 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 35 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 36 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 37 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 38 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 39 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 41 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 42 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 43 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 44 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_125172 | 3300042659 | Bacteria | 3587 |
| 2 | Ga0466657_067328 | 3300042582 | Bacteria | 1276 |
| 3 | Ga0466657_197278 | 3300042582 | Bacteria | 3255 |
| 4 | Ga0466694_167066 | 3300042594 | Bacteria | 4459 |
| 5 | Ga0466694_366413 | 3300042594 | Bacteria | 1391 |
| 6 | Ga0466694_367796 | 3300042594 | Unclassified | 1548 |
| 7 | Ga0466699_009423 | 3300042597 | Bacteria | 1632 |
| 8 | Ga0466712_219870 | 3300042614 | Bacteria | 3286 |
| 9 | Ga0466712_223771 | 3300042614 | Unclassified | 1811 |
| 10 | Ga0466718_033604 | 3300042617 | Bacteria | 3655 |
| 11 | Ga0123356_10041044 | 3300010049 | Unclassified | 4312 |
| 12 | Ga0123356_10280564 | 3300010049 | Bacteria | 1761 |
| 13 | Ga0123356_10317154 | 3300010049 | Bacteria | 1670 |
| 14 | Ga0123356_10558821 | 3300010049 | Bacteria | 1306 |
| 15 | Ga0123356_11898997 | 3300010049 | Bacteria | 741 |
| 16 | Ga0466721_379635 | 3300042608 | Unclassified | 1266 |
| 17 | Ga0466722_110217 | 3300042609 | Bacteria | 1028 |
| 18 | Ga0466698_356168 | 3300042610 | Unclassified | 1326 |
| 19 | JGI24695J34938_10006483 | 3300002450 | Bacteria | 7010 |
| 20 | Ga0466725_212046 | 3300042654 | Bacteria | 12971 |
| 21 | Ga0466690_398811 | 3300042590 | Bacteria | 2900 |
| 22 | Ga0466693_225080 | 3300042592 | Bacteria | 4207 |
| 23 | Ga0466694_005411 | 3300042594 | Bacteria | 1839 |
| 24 | Ga0123355_11048179 | 3300009826 | Unclassified | 857 |
| 25 | Ga0123356_10000271 | 3300010049 | Bacteria | 59375 |
| 26 | Ga0123356_10002946 | 3300010049 | Bacteria | 18005 |
| 27 | Ga0123356_13245140 | 3300010049 | Bacteria | 566 |
| 28 | Ga0123353_10544151 | 3300010167 | Bacteria | 1677 |
| 29 | Ga0466700_294567 | 3300042600 | Bacteria | 3675 |
| 30 | Ga0466720_191073 | 3300042607 | Unclassified | 1707 |
| 31 | JGI24698J34947_10110436 | 3300002449 | Bacteria | 1215 |
| 32 | JGI24698J34947_10147672 | 3300002449 | Bacteria | 981 |
| 33 | JGI24697J35500_10761164 | 3300002507 | Unclassified | 682 |
| 34 | Ga0072941_1086804 | 3300005201 | Unclassified | 992 |
| 35 | Ga0466735_032310 | 3300042624 | Bacteria | 1046 |
| 36 | Ga0466708_193213 | 3300042652 | Bacteria | 16515 |
| 37 | Ga0264413_147287 | 3300024493 | Unclassified | 1499 |
| 38 | Ga0264413_147487 | 3300024493 | Bacteria | 1622 |
| 39 | Ga0466699_322840 | 3300042597 | Bacteria | 1645 |
| 40 | Ga0466718_062916 | 3300042617 | Bacteria | 1674 |
| 41 | Ga0466718_148497 | 3300042617 | Bacteria | 1126 |
| 42 | Ga0466723_070905 | 3300042618 | Bacteria | 2863 |
| 43 | Ga0123357_10556076 | 3300009784 | Bacteria | 911 |
| 44 | Ga0123356_11727223 | 3300010049 | Bacteria | 777 |
| 45 | Ga0466707_277514 | 3300042601 | Bacteria | 1054 |
| 46 | JGI24698J34947_10066609 | 3300002449 | Unclassified | 1752 |
| 47 | JGI24695J34938_10028985 | 3300002450 | Bacteria | 2593 |
| 48 | Ga0123357_10001131 | 3300009784 | Bacteria | 27706 |
| 49 | Ga0466734_094210 | 3300042623 | Bacteria | 1336 |
| 50 | Ga0466725_440362 | 3300042654 | Bacteria | 2478 |
| 51 | Ga0466727_137916 | 3300042655 | Bacteria | 2889 |
| 52 | Ga0415639_119678 | 3300038395 | Unclassified | 1057 |
| 53 | Ga0466692_058972 | 3300042591 | Unclassified | 1037 |
| 54 | Ga0466712_169138 | 3300042614 | Unclassified | 8393 |
| 55 | Ga0466712_251153 | 3300042614 | Bacteria | 2856 |
| 56 | Ga0466718_098829 | 3300042617 | Bacteria | 1160 |
| 57 | Ga0466726_096063 | 3300042619 | Bacteria | 11005 |
| 58 | Ga0123356_10138638 | 3300010049 | Bacteria | 2396 |
| 59 | Ga0123356_11674819 | 3300010049 | Bacteria | 789 |
| 60 | Ga0123353_10375567 | 3300010167 | Unclassified | 2129 |
| 61 | Ga0123353_13388055 | 3300010167 | Unclassified | 506 |
| 62 | Ga0466700_003242 | 3300042600 | Unclassified | 1039 |
| 63 | Ga0466720_092902 | 3300042607 | Bacteria | 3060 |
| 64 | AustNasuHG_c1000280 | 3300000089 | Bacteria | 17596 |
| 65 | JGI24698J34947_10124581 | 3300002449 | Bacteria | 1112 |
| 66 | JGI24695J34938_10086917 | 3300002450 | Bacteria | 1286 |
| 67 | Ga0466704_122107 | 3300042643 | Unclassified | 1153 |
| 68 | Ga0466727_042561 | 3300042655 | Bacteria | 1438 |
| 69 | Ga0466727_065314 | 3300042655 | Unclassified | 2514 |
| 70 | Ga0466699_095383 | 3300042597 | Bacteria | 1558 |
| 71 | Ga0466718_026054 | 3300042617 | Bacteria | 12053 |
| 72 | Ga0466718_032960 | 3300042617 | Bacteria | 1051 |
| 73 | Ga0123357_10300230 | 3300009784 | Bacteria | 1624 |
| 74 | Ga0123356_10014536 | 3300010049 | Bacteria | 7565 |
| 75 | Ga0123356_10035904 | 3300010049 | Bacteria | 4628 |
| 76 | Ga0123356_13428164 | 3300010049 | Bacteria | 550 |
| 77 | Ga0466707_218214 | 3300042601 | Bacteria | 1521 |
| 78 | Ga0466720_147689 | 3300042607 | Unclassified | 1812 |
| 79 | JGI24698J34947_10001394 | 3300002449 | Bacteria | 12716 |
| 80 | JGI24698J34947_10006149 | 3300002449 | Bacteria | 6593 |
| 81 | JGI24698J34947_10027065 | 3300002449 | Bacteria | 3043 |
| 82 | JGI24697J35500_10936184 | 3300002507 | Unclassified | 851 |
| 83 | Ga0072941_1077589 | 3300005201 | Bacteria | 2791 |
| 84 | Ga0072941_1290499 | 3300005201 | Bacteria | 1723 |
| 85 | Ga0466731_211352 | 3300042622 | Bacteria | 3224 |
| 86 | Ga0466731_297429 | 3300042622 | Bacteria | 1090 |
| 87 | Ga0466725_028863 | 3300042654 | Bacteria | 11394 |
| 88 | Ga0466727_113578 | 3300042655 | Bacteria | 1410 |
| 89 | Ga0223687_124258 | 3300021217 | Bacteria | 680 |
| 90 | Ga0264413_132429 | 3300024493 | Unclassified | 1712 |
| 91 | Ga0415639_127181 | 3300038395 | Bacteria | 1115 |
| 92 | Ga0466692_128738 | 3300042591 | Bacteria | 1724 |
| 93 | Ga0466712_242615 | 3300042614 | Bacteria | 1089 |
| 94 | Ga0466718_005865 | 3300042617 | Unclassified | 1072 |
| 95 | Ga0466726_262541 | 3300042619 | Bacteria | 2274 |
| 96 | Ga0466726_361428 | 3300042619 | Bacteria | 1984 |
| 97 | Ga0123356_11857617 | 3300010049 | Bacteria | 750 |
| 98 | Ga0123353_10687081 | 3300010167 | Bacteria | 1440 |
| 99 | Ga0123353_10756325 | 3300010167 | Bacteria | 1351 |
| 100 | Ga0466714_083548 | 3300042603 | Bacteria | 1686 |
| 101 | JGI24698J34947_10029870 | 3300002449 | Bacteria | 2877 |
| 102 | JGI24698J34947_10030080 | 3300002449 | Unclassified | 2866 |
| 103 | JGI24698J34947_10089405 | 3300002449 | Unclassified | 1418 |
| 104 | JGI24702J35022_10036559 | 3300002462 | Unclassified | 2625 |
| 105 | Ga0072940_1137377 | 3300005200 | Bacteria | 782 |
| 106 | Ga0466704_068967 | 3300042643 | Bacteria | 7305 |
| 107 | Ga0466727_242601 | 3300042655 | Bacteria | 2896 |
| 108 | Ga0255786_1016559 | 3300022815 | Unclassified | 862 |
| 109 | Ga0466726_335679 | 3300042619 | Bacteria | 2462 |
| 110 | Ga0123356_10327409 | 3300010049 | Bacteria | 1647 |
| 111 | Ga0123353_13018857 | 3300010167 | Unclassified | 544 |
| 112 | Ga0123353_13136120 | 3300010167 | Unclassified | 531 |
| 113 | Ga0123353_13394711 | 3300010167 | Unclassified | 505 |
| 114 | Ga0466707_062937 | 3300042601 | Bacteria | 1873 |
| 115 | Ga0466719_357492 | 3300042606 | Bacteria | 1669 |
| 116 | JGI24698J34947_10027618 | 3300002449 | Bacteria | 3010 |
| 117 | JGI24698J34947_10029900 | 3300002449 | Unclassified | 2875 |
| 118 | JGI24702J35022_10535985 | 3300002462 | Bacteria | 720 |
| 119 | Ga0072940_1012908 | 3300005200 | Bacteria | 3531 |
| 120 | Ga0466734_001682 | 3300042623 | Bacteria | 2896 |
| 121 | Ga0466727_232576 | 3300042655 | Bacteria | 3047 |
| 122 | Ga0466694_256786 | 3300042594 | Bacteria | 1947 |
| 123 | Ga0466712_030137 | 3300042614 | Bacteria | 4000 |
| 124 | Ga0466718_094146 | 3300042617 | Unclassified | 1870 |
| 125 | Ga0123357_10535911 | 3300009784 | Bacteria | 945 |
| 126 | Ga0123355_10064169 | 3300009826 | Bacteria | 5921 |
| 127 | Ga0123356_10004149 | 3300010049 | Bacteria | 15035 |
| 128 | Ga0123353_10394622 | 3300010167 | Unclassified | 2062 |
| 129 | Ga0466720_019126 | 3300042607 | Bacteria | 2258 |
| 130 | AustNasuHG_c1029287 | 3300000089 | Bacteria | 1618 |
| 131 | AustNasuHG_c1060473 | 3300000089 | Bacteria | 736 |
| 132 | JGI24698J34947_10253720 | 3300002449 | Bacteria | 656 |
| 133 | JGI24695J34938_10013437 | 3300002450 | Bacteria | 4301 |
| 134 | JGI24702J35022_10018758 | 3300002462 | Bacteria | 3770 |
| 135 | JGI24702J35022_10150853 | 3300002462 | Bacteria | 1304 |
| 136 | JGI24702J35022_10569760 | 3300002462 | Bacteria | 699 |
| 137 | Ga0123357_10000093 | 3300009784 | Bacteria | 72529 |
| 138 | Ga0466704_285544 | 3300042643 | Bacteria | 1753 |
| 139 | Ga0466727_010234 | 3300042655 | Bacteria | 1397 |
| 140 | Ga0466727_336041 | 3300042655 | Bacteria | 1392 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300038395 | Ga0415639_127181 | Ga0415639_127181_821_1096 | 91 |
| 2 | 3300042590 | Ga0466690_398811 | Ga0466690_398811_682_957 | 91 |
| 3 | 3300010167 | Ga0123353_13136120 | Ga0123353_131361201 | 92 |
| 4 | 3300042591 | Ga0466692_058972 | Ga0466692_058972_25_306 | 93 |
| 5 | 3300042591 | Ga0466692_128738 | Ga0466692_128738_1432_1713 | 93 |
| 6 | 3300042597 | Ga0466699_095383 | Ga0466699_095383_864_1166 | 100 |
| 7 | 3300022815 | Ga0255786_1016559 | Ga0255786_10165592 | 102 |
| 8 | 3300024493 | Ga0264413_132429 | Ga0264413_1324292 | 102 |
| 9 | 3300024493 | Ga0264413_147287 | Ga0264413_1472871 | 102 |
| 10 | 3300024493 | Ga0264413_147487 | Ga0264413_1474871 | 102 |
| 11 | 3300042592 | Ga0466693_225080 | Ga0466693_225080_401_709 | 102 |
| 12 | 3300042594 | Ga0466694_005411 | Ga0466694_005411_287_595 | 102 |
| 13 | 3300042594 | Ga0466694_167066 | Ga0466694_167066_3663_3971 | 102 |
| 14 | 3300042594 | Ga0466694_256786 | Ga0466694_256786_611_919 | 102 |
| 15 | 3300042594 | Ga0466694_366413 | Ga0466694_366413_644_952 | 102 |
| 16 | 3300042594 | Ga0466694_367796 | Ga0466694_367796_65_373 | 102 |
| 17 | 3300042597 | Ga0466699_009423 | Ga0466699_009423_1059_1367 | 102 |
| 18 | 3300042600 | Ga0466700_294567 | Ga0466700_294567_2458_2766 | 102 |
| 19 | 3300042601 | Ga0466707_218214 | Ga0466707_218214_464_772 | 102 |
| 20 | 3300042603 | Ga0466714_083548 | Ga0466714_083548_1162_1470 | 102 |
| 21 | 3300042606 | Ga0466719_357492 | Ga0466719_357492_24_332 | 102 |
| 22 | 3300042607 | Ga0466720_019126 | Ga0466720_019126_52_360 | 102 |
| 23 | 3300042607 | Ga0466720_092902 | Ga0466720_092902_696_1004 | 102 |
| 24 | 3300042607 | Ga0466720_147689 | Ga0466720_147689_257_565 | 102 |
| 25 | 3300042607 | Ga0466720_191073 | Ga0466720_191073_435_743 | 102 |
| 26 | 3300042608 | Ga0466721_379635 | Ga0466721_379635_341_649 | 102 |
| 27 | 3300042609 | Ga0466722_110217 | Ga0466722_110217_464_772 | 102 |
| 28 | 3300042610 | Ga0466698_356168 | Ga0466698_356168_343_651 | 102 |
| 29 | 3300042614 | Ga0466712_030137 | Ga0466712_030137_1686_1994 | 102 |
| 30 | 3300042614 | Ga0466712_169138 | Ga0466712_169138_6482_6790 | 102 |
| 31 | 3300042614 | Ga0466712_219870 | Ga0466712_219870_2256_2564 | 102 |
| 32 | 3300042614 | Ga0466712_223771 | Ga0466712_223771_161_469 | 102 |
| 33 | 3300042614 | Ga0466712_242615 | Ga0466712_242615_406_714 | 102 |
| 34 | 3300042614 | Ga0466712_251153 | Ga0466712_251153_378_686 | 102 |
| 35 | 3300042617 | Ga0466718_005865 | Ga0466718_005865_132_440 | 102 |
| 36 | 3300042617 | Ga0466718_026054 | Ga0466718_026054_7986_8294 | 102 |
| 37 | 3300042617 | Ga0466718_032960 | Ga0466718_032960_271_579 | 102 |
| 38 | 3300042617 | Ga0466718_033604 | Ga0466718_033604_668_976 | 102 |
| 39 | 3300042617 | Ga0466718_062916 | Ga0466718_062916_757_1065 | 102 |
| 40 | 3300042617 | Ga0466718_094146 | Ga0466718_094146_513_821 | 102 |
| 41 | 3300042617 | Ga0466718_098829 | Ga0466718_098829_721_1029 | 102 |
| 42 | 3300042618 | Ga0466723_070905 | Ga0466723_070905_1221_1529 | 102 |
| 43 | 3300042619 | Ga0466726_096063 | Ga0466726_096063_5560_5868 | 102 |
| 44 | 3300042619 | Ga0466726_262541 | Ga0466726_262541_539_847 | 102 |
| 45 | 3300042619 | Ga0466726_335679 | Ga0466726_335679_733_1041 | 102 |
| 46 | 3300042619 | Ga0466726_361428 | Ga0466726_361428_518_826 | 102 |
| 47 | 3300042622 | Ga0466731_211352 | Ga0466731_211352_110_418 | 102 |
| 48 | 3300042624 | Ga0466735_032310 | Ga0466735_032310_597_905 | 102 |
| 49 | 3300042643 | Ga0466704_285544 | Ga0466704_285544_896_1204 | 102 |
| 50 | 3300042652 | Ga0466708_193213 | Ga0466708_193213_13356_13664 | 102 |
| 51 | 3300042655 | Ga0466727_010234 | Ga0466727_010234_237_545 | 102 |
| 52 | 3300042655 | Ga0466727_042561 | Ga0466727_042561_650_958 | 102 |
| 53 | 3300042655 | Ga0466727_065314 | Ga0466727_065314_1935_2243 | 102 |
| 54 | 3300042655 | Ga0466727_137916 | Ga0466727_137916_1882_2190 | 102 |
| 55 | 3300042655 | Ga0466727_232576 | Ga0466727_232576_155_463 | 102 |
| 56 | 3300042655 | Ga0466727_242601 | Ga0466727_242601_2093_2401 | 102 |
| 57 | 3300042655 | Ga0466727_336041 | Ga0466727_336041_371_679 | 102 |
| 58 | 3300042659 | Ga0466733_125172 | Ga0466733_125172_283_591 | 102 |
| 59 | iso_pr_bacteria | 2531839311 | 2533038471 | 102 |
| 60 | iso_pr_bacteria | 2781125656 | 2781321224 | 102 |
| 61 | iso_pr_bacteria | 2781125662 | 2781335735 | 102 |
| 62 | iso_pr_bacteria | 2781125666 | 2781343389 | 102 |
| 63 | iso_pr_bacteria | 2781125691 | 2781429665 | 102 |
| 64 | iso_pr_bacteria | 2820027804 | 2820029947 | 102 |
| 65 | 3300000089 | AustNasuHG_c1000280 | AustNasuHG_100028018 | 103 |
| 66 | 3300000089 | AustNasuHG_c1029287 | AustNasuHG_10292871 | 103 |
| 67 | 3300000089 | AustNasuHG_c1060473 | AustNasuHG_10604731 | 103 |
| 68 | 3300002449 | JGI24698J34947_10001394 | JGI24698J34947_1000139415 | 103 |
| 69 | 3300002449 | JGI24698J34947_10006149 | JGI24698J34947_100061494 | 103 |
| 70 | 3300002449 | JGI24698J34947_10027065 | JGI24698J34947_100270655 | 103 |
| 71 | 3300002449 | JGI24698J34947_10027618 | JGI24698J34947_100276183 | 103 |
| 72 | 3300002449 | JGI24698J34947_10029870 | JGI24698J34947_100298703 | 103 |
| 73 | 3300002449 | JGI24698J34947_10029900 | JGI24698J34947_100299002 | 103 |
| 74 | 3300002449 | JGI24698J34947_10030080 | JGI24698J34947_100300803 | 103 |
| 75 | 3300002449 | JGI24698J34947_10066609 | JGI24698J34947_100666092 | 103 |
| 76 | 3300002449 | JGI24698J34947_10089405 | JGI24698J34947_100894052 | 103 |
| 77 | 3300002449 | JGI24698J34947_10110436 | JGI24698J34947_101104362 | 103 |
| 78 | 3300002449 | JGI24698J34947_10124581 | JGI24698J34947_101245811 | 103 |
| 79 | 3300002449 | JGI24698J34947_10147672 | JGI24698J34947_101476722 | 103 |
| 80 | 3300002449 | JGI24698J34947_10253720 | JGI24698J34947_102537201 | 103 |
| 81 | 3300002450 | JGI24695J34938_10006483 | JGI24695J34938_100064832 | 103 |
| 82 | 3300002450 | JGI24695J34938_10013437 | JGI24695J34938_100134372 | 103 |
| 83 | 3300002450 | JGI24695J34938_10028985 | JGI24695J34938_100289852 | 103 |
| 84 | 3300002450 | JGI24695J34938_10086917 | JGI24695J34938_100869173 | 103 |
| 85 | 3300002462 | JGI24702J35022_10018758 | JGI24702J35022_100187583 | 103 |
| 86 | 3300002462 | JGI24702J35022_10150853 | JGI24702J35022_101508533 | 103 |
| 87 | 3300002462 | JGI24702J35022_10535985 | JGI24702J35022_105359852 | 103 |
| 88 | 3300002462 | JGI24702J35022_10569760 | JGI24702J35022_105697602 | 103 |
| 89 | 3300002507 | JGI24697J35500_10761164 | JGI24697J35500_107611642 | 103 |
| 90 | 3300002507 | JGI24697J35500_10936184 | JGI24697J35500_109361842 | 103 |
| 91 | 3300005200 | Ga0072940_1012908 | Ga0072940_10129084 | 103 |
| 92 | 3300005200 | Ga0072940_1137377 | Ga0072940_11373773 | 103 |
| 93 | 3300005201 | Ga0072941_1077589 | Ga0072941_10775891 | 103 |
| 94 | 3300005201 | Ga0072941_1086804 | Ga0072941_10868041 | 103 |
| 95 | 3300005201 | Ga0072941_1290499 | Ga0072941_12904994 | 103 |
| 96 | 3300009784 | Ga0123357_10000093 | Ga0123357_1000009334 | 103 |
| 97 | 3300009784 | Ga0123357_10001131 | Ga0123357_1000113139 | 103 |
| 98 | 3300009784 | Ga0123357_10300230 | Ga0123357_103002304 | 103 |
| 99 | 3300009826 | Ga0123355_10064169 | Ga0123355_100641692 | 103 |
| 100 | 3300009826 | Ga0123355_11048179 | Ga0123355_110481792 | 103 |
| 101 | 3300010049 | Ga0123356_10000271 | Ga0123356_1000027135 | 103 |
| 102 | 3300010049 | Ga0123356_10002946 | Ga0123356_100029467 | 103 |
| 103 | 3300010049 | Ga0123356_10004149 | Ga0123356_100041494 | 103 |
| 104 | 3300010049 | Ga0123356_10014536 | Ga0123356_100145366 | 103 |
| 105 | 3300010049 | Ga0123356_10035904 | Ga0123356_100359042 | 103 |
| 106 | 3300010049 | Ga0123356_10041044 | Ga0123356_100410441 | 103 |
| 107 | 3300010049 | Ga0123356_10317154 | Ga0123356_103171543 | 103 |
| 108 | 3300010049 | Ga0123356_10327409 | Ga0123356_103274092 | 103 |
| 109 | 3300010049 | Ga0123356_10558821 | Ga0123356_105588211 | 103 |
| 110 | 3300010049 | Ga0123356_11674819 | Ga0123356_116748192 | 103 |
| 111 | 3300010049 | Ga0123356_11898997 | Ga0123356_118989972 | 103 |
| 112 | 3300010049 | Ga0123356_13245140 | Ga0123356_132451402 | 103 |
| 113 | 3300010167 | Ga0123353_10375567 | Ga0123353_103755672 | 103 |
| 114 | 3300010167 | Ga0123353_10394622 | Ga0123353_103946223 | 103 |
| 115 | 3300010167 | Ga0123353_10687081 | Ga0123353_106870813 | 103 |
| 116 | 3300010167 | Ga0123353_10756325 | Ga0123353_107563251 | 103 |
| 117 | 3300010167 | Ga0123353_13018857 | Ga0123353_130188571 | 103 |
| 118 | 3300010167 | Ga0123353_13388055 | Ga0123353_133880551 | 103 |
| 119 | 3300010167 | Ga0123353_13394711 | Ga0123353_133947111 | 103 |
| 120 | 3300021217 | Ga0223687_124258 | Ga0223687_1242582 | 103 |
| 121 | 3300038395 | Ga0415639_119678 | Ga0415639_119678_256_567 | 103 |
| 122 | 3300042643 | Ga0466704_122107 | Ga0466704_122107_294_605 | 103 |
| 123 | 3300009784 | Ga0123357_10556076 | Ga0123357_105560762 | 104 |
| 124 | 3300010167 | Ga0123353_10544151 | Ga0123353_105441512 | 104 |
| 125 | 3300042582 | Ga0466657_197278 | Ga0466657_197278_1616_1930 | 104 |
| 126 | 3300042597 | Ga0466699_322840 | Ga0466699_322840_604_918 | 104 |
| 127 | 3300042601 | Ga0466707_062937 | Ga0466707_062937_1403_1717 | 104 |
| 128 | 3300042601 | Ga0466707_277514 | Ga0466707_277514_129_443 | 104 |
| 129 | 3300042623 | Ga0466734_094210 | Ga0466734_094210_69_383 | 104 |
| 130 | 3300010049 | Ga0123356_10280564 | Ga0123356_102805642 | 105 |
| 131 | 3300010049 | Ga0123356_11857617 | Ga0123356_118576171 | 105 |
| 132 | 3300010049 | Ga0123356_13428164 | Ga0123356_134281642 | 105 |
| 133 | 3300042622 | Ga0466731_297429 | Ga0466731_297429_213_530 | 105 |
| 134 | 3300002462 | JGI24702J35022_10036559 | JGI24702J35022_100365593 | 106 |
| 135 | 3300042643 | Ga0466704_068967 | Ga0466704_068967_995_1318 | 107 |
| 136 | 3300042654 | Ga0466725_212046 | Ga0466725_212046_10506_10829 | 107 |
| 137 | 3300042654 | Ga0466725_028863 | Ga0466725_028863_11009_11335 | 108 |
| 138 | 3300042600 | Ga0466700_003242 | Ga0466700_003242_78_407 | 109 |
| 139 | 3300042617 | Ga0466718_148497 | Ga0466718_148497_649_978 | 109 |
| 140 | 3300042623 | Ga0466734_001682 | Ga0466734_001682_818_1147 | 109 |
| 141 | 3300042654 | Ga0466725_440362 | Ga0466725_440362_61_390 | 109 |
| 142 | 3300042655 | Ga0466727_113578 | Ga0466727_113578_166_495 | 109 |
| 143 | 3300010049 | Ga0123356_10138638 | Ga0123356_101386383 | 110 |
| 144 | 3300042582 | Ga0466657_067328 | Ga0466657_067328_746_1081 | 111 |
| 145 | 3300009784 | Ga0123357_10535911 | Ga0123357_105359112 | 125 |
| 146 | 3300010049 | Ga0123356_11727223 | Ga0123356_117272232 | 132 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13744 | HTH_37 | Helix-turn-helix domain | 20 | 86 | 0.9 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.35 | 0.62 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.