Protein Family IF03994
Metagenome
Isolate
286
Members
93
Samples
252
Scaffolds
390.37
Avg Length
Representative Sequence
- ID
- 3300012849|Ga0160447_101274|Ga0160447_1012743
- Length
- 450 aa
- Sequence
- MLETIHPAQVLTTRQQGQENQRSHGLFAFGDMPWEVGEPKWGYGGRSFAPIVFYRLPTGVPRMSIQVEDYFEKSTFEKMKAFADKQETPFVLIDTAMISKAYDDLRAGFEFAKVYYAVKANPAVEIIDLLKEKGSSFDIASIYELDKVMDRGVGPDRISYGNTIKKSKDIRYFYDKGVRLYATDSEADLRNIAKAAPGSKVYVRILTEGSTTADWPLSRKFGCQTDMAMDLLILARDLGLVPYGISFHVGSQQRDISVWDAAIAKVKVIFERLKEEDGIELKLINMGGGFPANYITRTNSLETYAEEIIRFLKEDFGDDLPEIILEPGRSLIANAGILVSEVVLVARKSRTAVERWVYTDVGKFSGLIETMDEAIKFPIWTEKKGEVEEVVIAGPTCDSADIMYENYKYGLPLNLAIGDRLYWLSTGAYTTSYSAVEFNGFPPLKSFYV*
Sample Types
Isolate
11.9%
Metagenome
88.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
21.6%
Unclassified
18.2%
Kalotermitidae
15.9%
Curculionidae
11.4%
Elmidae
9.1%
Culicidae
6.8%
Armadillidiidae
5.7%
Termopsidae
4.5%
Rhinotermitidae
2.3%
Hodotermitidae
1.1%
Trigoniulidae
1.1%
Gryllidae
1.1%
Siricidae
1.1%
Taxonomy
Archaea
2
Bacteria
246
Eukaryota
0
Viruses
0
Unclassified
38
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 2 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 3 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 4 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 5 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 8 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 15 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 16 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 17 | 2228664002 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3a from Florida, USA | Metagenome | Termitidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 21 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 28 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 31 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 32 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 33 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 34 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 35 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 36 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 37 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 38 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 39 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 40 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 44 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 45 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 46 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 47 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 48 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 49 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 50 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 51 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 52 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 56 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 57 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 58 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 59 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 60 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 61 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 62 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 63 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 64 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 65 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 66 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 67 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 68 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 69 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 70 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 71 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 72 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 73 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 74 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 75 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 76 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 77 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 78 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 79 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 80 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 81 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 82 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 83 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 84 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 85 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 86 | 2820008971 | Unclassified Synergistetes Lab288P3bin103 | Isolate | Unclassified |
| 87 | 2820201435 | Unclassified Planctomycetes Cu122P5bin25 | Isolate | Unclassified |
| 88 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 89 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 90 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 91 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 92 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 93 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466703_336077 | 3300042636 | Bacteria | 10216 |
| 2 | Ga0466704_262049 | 3300042643 | Bacteria | 8186 |
| 3 | Ga0466708_301184 | 3300042652 | Bacteria | 10392 |
| 4 | Ga0466727_038691 | 3300042655 | Bacteria | 4650 |
| 5 | Ga0466727_224882 | 3300042655 | Bacteria | 4803 |
| 6 | Ga0466711_217673 | 3300042615 | Bacteria | 15463 |
| 7 | Ga0466718_095017 | 3300042617 | Bacteria | 6920 |
| 8 | Ga0466728_017508 | 3300042620 | Bacteria | 3287 |
| 9 | Ga0466728_074005 | 3300042620 | Bacteria | 2033 |
| 10 | Ga0466728_225962 | 3300042620 | Unclassified | 1785 |
| 11 | Ga0466691_194999 | 3300042593 | Bacteria | 3887 |
| 12 | Ga0466699_072196 | 3300042597 | Bacteria | 50938 |
| 13 | Ga0466699_206045 | 3300042597 | Bacteria | 8454 |
| 14 | Ga0466707_319373 | 3300042601 | Bacteria | 6155 |
| 15 | Ga0466716_075509 | 3300042605 | Bacteria | 2450 |
| 16 | Ga0466716_437171 | 3300042605 | Unclassified | 3297 |
| 17 | Ga0466719_360216 | 3300042606 | Unclassified | 3717 |
| 18 | Ga0466720_024246 | 3300042607 | Bacteria | 11988 |
| 19 | Ga0466720_117331 | 3300042607 | Bacteria | 25963 |
| 20 | Ga0466722_090113 | 3300042609 | Bacteria | 54651 |
| 21 | SWWA_contig20077__length_3098___numreads_51 | 2100351016 | Unclassified | 3098 |
| 22 | 2230941932 | 2228664002 | Bacteria | 4000 |
| 23 | AustNasuHG_c1027411 | 3300000089 | Unclassified | 1740 |
| 24 | AustNasuHG_c1027798 | 3300000089 | Bacteria | 1711 |
| 25 | Ga0466703_369343 | 3300042636 | Bacteria | 7096 |
| 26 | Ga0466704_058058 | 3300042643 | Bacteria | 7764 |
| 27 | Ga0466704_466622 | 3300042643 | Bacteria | 8165 |
| 28 | Ga0466709_310969 | 3300042648 | Bacteria | 5202 |
| 29 | Ga0466724_22286 | 3300042649 | Bacteria | 91157 |
| 30 | Ga0466708_068100 | 3300042652 | Bacteria | 6219 |
| 31 | Ga0466708_082024 | 3300042652 | Bacteria | 17983 |
| 32 | Ga0466708_182979 | 3300042652 | Bacteria | 4034 |
| 33 | Ga0466727_126736 | 3300042655 | Bacteria | 3689 |
| 34 | Ga0466727_138008 | 3300042655 | Bacteria | 1672 |
| 35 | Ga0466727_142913 | 3300042655 | Bacteria | 1951 |
| 36 | Ga0466711_001550 | 3300042615 | Bacteria | 2616 |
| 37 | Ga0466711_047918 | 3300042615 | Bacteria | 3010 |
| 38 | Ga0466711_260410 | 3300042615 | Bacteria | 34066 |
| 39 | Ga0466723_036905 | 3300042618 | Bacteria | 2271 |
| 40 | Ga0466723_056169 | 3300042618 | Bacteria | 18896 |
| 41 | Ga0466723_268309 | 3300042618 | Bacteria | 19008 |
| 42 | Ga0466723_370887 | 3300042618 | Bacteria | 4222 |
| 43 | Ga0466726_441163 | 3300042619 | Bacteria | 1389 |
| 44 | Ga0466728_229486 | 3300042620 | Bacteria | 9527 |
| 45 | Ga0466696_136667 | 3300042596 | Bacteria | 10326 |
| 46 | Ga0466699_197185 | 3300042597 | Bacteria | 2238 |
| 47 | Ga0466706_254842 | 3300042599 | Bacteria | 1390 |
| 48 | Ga0466716_132556 | 3300042605 | Bacteria | 104704 |
| 49 | Ga0466716_361203 | 3300042605 | Bacteria | 19363 |
| 50 | Ga0466719_078840 | 3300042606 | Bacteria | 12999 |
| 51 | Ga0466719_122179 | 3300042606 | Bacteria | 1747 |
| 52 | Ga0466720_066128 | 3300042607 | Bacteria | 3575 |
| 53 | Ga0466698_119924 | 3300042610 | Bacteria | 3078 |
| 54 | JGI24698J34947_10095810 | 3300002449 | Bacteria | 1348 |
| 55 | JGI24702J35022_10032757 | 3300002462 | Bacteria | 2781 |
| 56 | Ga0466705_177386 | 3300042612 | Unclassified | 2977 |
| 57 | Ga0466703_092269 | 3300042636 | Bacteria | 35163 |
| 58 | Ga0466703_115513 | 3300042636 | Bacteria | 25517 |
| 59 | Ga0466703_178641 | 3300042636 | Bacteria | 19143 |
| 60 | Ga0466704_539489 | 3300042643 | Unclassified | 8815 |
| 61 | Ga0466708_169423 | 3300042652 | Unclassified | 4572 |
| 62 | Ga0466725_041273 | 3300042654 | Bacteria | 4788 |
| 63 | Ga0466711_103306 | 3300042615 | Bacteria | 1639 |
| 64 | Ga0466723_236775 | 3300042618 | Bacteria | 6769 |
| 65 | Ga0466726_197156 | 3300042619 | Bacteria | 2043 |
| 66 | Ga0466726_263679 | 3300042619 | Unclassified | 2903 |
| 67 | Ga0466728_184572 | 3300042620 | Bacteria | 2775 |
| 68 | Ga0466728_186898 | 3300042620 | Bacteria | 1821 |
| 69 | Ga0466690_052938 | 3300042590 | Unclassified | 1742 |
| 70 | Ga0466691_113820 | 3300042593 | Bacteria | 3855 |
| 71 | Ga0466700_005690 | 3300042600 | Archaea | 1868 |
| 72 | Ga0466707_396685 | 3300042601 | Bacteria | 2686 |
| 73 | Ga0466713_018772 | 3300042602 | Bacteria | 5128 |
| 74 | Ga0466713_089445 | 3300042602 | Bacteria | 37767 |
| 75 | Ga0466713_128394 | 3300042602 | Bacteria | 12056 |
| 76 | Ga0466719_137690 | 3300042606 | Bacteria | 11186 |
| 77 | Ga0466720_067158 | 3300042607 | Bacteria | 7408 |
| 78 | Ga0466720_228515 | 3300042607 | Bacteria | 2364 |
| 79 | Ga0466722_022228 | 3300042609 | Bacteria | 12845 |
| 80 | DPO_contig00817 | 2032320009 | Unclassified | 1241 |
| 81 | AustNasuHG_c1030662 | 3300000089 | Bacteria | 1542 |
| 82 | JGI24702J35022_10004684 | 3300002462 | Bacteria | 8098 |
| 83 | Ga0068302_10338451 | 3300005071 | Bacteria | 2581 |
| 84 | Ga0072941_1046960 | 3300005201 | Bacteria | 1455 |
| 85 | Ga0072941_1047006 | 3300005201 | Bacteria | 14717 |
| 86 | Ga0466705_189370 | 3300042612 | Unclassified | 4390 |
| 87 | Ga0466705_329816 | 3300042612 | Bacteria | 3856 |
| 88 | Ga0466702_182007 | 3300042635 | Bacteria | 3082 |
| 89 | Ga0466704_215741 | 3300042643 | Bacteria | 1800 |
| 90 | Ga0466709_214407 | 3300042648 | Bacteria | 21667 |
| 91 | Ga0466708_217150 | 3300042652 | Bacteria | 6872 |
| 92 | Ga0466708_238477 | 3300042652 | Bacteria | 18878 |
| 93 | Ga0466708_436672 | 3300042652 | Bacteria | 4354 |
| 94 | Ga0466715_011378 | 3300042616 | Bacteria | 8376 |
| 95 | Ga0466715_066944 | 3300042616 | Bacteria | 42935 |
| 96 | Ga0466723_135088 | 3300042618 | Bacteria | 24800 |
| 97 | Ga0466723_243621 | 3300042618 | Bacteria | 5464 |
| 98 | Ga0466726_348620 | 3300042619 | Bacteria | 2680 |
| 99 | Ga0466728_381622 | 3300042620 | Bacteria | 6445 |
| 100 | Ga0160467_103418 | 3300012829 | Unclassified | 2696 |
| 101 | Ga0160455_101764 | 3300012837 | Unclassified | 5591 |
| 102 | Ga0160433_100085 | 3300012846 | Bacteria | 96359 |
| 103 | Ga0160448_101175 | 3300012854 | Unclassified | 8584 |
| 104 | Ga0466690_112840 | 3300042590 | Bacteria | 21333 |
| 105 | Ga0466690_220357 | 3300042590 | Unclassified | 2006 |
| 106 | Ga0466690_257585 | 3300042590 | Bacteria | 1260 |
| 107 | Ga0466691_006402 | 3300042593 | Bacteria | 5250 |
| 108 | Ga0466699_162038 | 3300042597 | Bacteria | 3074 |
| 109 | Ga0466701_026761 | 3300042598 | Bacteria | 104248 |
| 110 | Ga0466716_295842 | 3300042605 | Bacteria | 8371 |
| 111 | Ga0466719_056822 | 3300042606 | Bacteria | 4377 |
| 112 | Ga0466719_371682 | 3300042606 | Bacteria | 9629 |
| 113 | Ga0466719_508314 | 3300042606 | Bacteria | 10843 |
| 114 | Ga0466720_219314 | 3300042607 | Unclassified | 2439 |
| 115 | Ga0466722_126444 | 3300042609 | Bacteria | 5982 |
| 116 | DPO_contig09127 | 2032320009 | Bacteria | 31539 |
| 117 | SPBB_contig11539 | 2044078006 | Bacteria | 54533 |
| 118 | FGTW_contig30594 | 2065487013 | Bacteria | 12222 |
| 119 | AustNasuHG_c1013838 | 3300000089 | Bacteria | 2757 |
| 120 | Ga0466705_091570 | 3300042612 | Bacteria | 1927 |
| 121 | Ga0466730_009157 | 3300042625 | Bacteria | 2931 |
| 122 | Ga0466703_005243 | 3300042636 | Bacteria | 4079 |
| 123 | Ga0466704_061323 | 3300042643 | Unclassified | 7666 |
| 124 | Ga0466709_131230 | 3300042648 | Bacteria | 7727 |
| 125 | Ga0466709_179562 | 3300042648 | Bacteria | 7166 |
| 126 | Ga0466709_288602 | 3300042648 | Bacteria | 1551 |
| 127 | Ga0466709_376965 | 3300042648 | Bacteria | 5558 |
| 128 | Ga0466708_424467 | 3300042652 | Unclassified | 6392 |
| 129 | Ga0466727_062892 | 3300042655 | Bacteria | 4671 |
| 130 | Ga0466705_408012 | 3300042612 | Unclassified | 5650 |
| 131 | Ga0466705_434603 | 3300042612 | Bacteria | 4671 |
| 132 | Ga0466712_078134 | 3300042614 | Bacteria | 4273 |
| 133 | Ga0466711_041610 | 3300042615 | Bacteria | 1650 |
| 134 | Ga0466711_217022 | 3300042615 | Bacteria | 16973 |
| 135 | Ga0466711_237833 | 3300042615 | Bacteria | 4531 |
| 136 | Ga0466711_440178 | 3300042615 | Bacteria | 6997 |
| 137 | Ga0466715_050591 | 3300042616 | Bacteria | 8335 |
| 138 | Ga0466715_058500 | 3300042616 | Bacteria | 11681 |
| 139 | Ga0466715_216666 | 3300042616 | Bacteria | 5116 |
| 140 | Ga0466715_398622 | 3300042616 | Bacteria | 8197 |
| 141 | Ga0466723_025944 | 3300042618 | Bacteria | 26067 |
| 142 | Ga0466723_186919 | 3300042618 | Bacteria | 11207 |
| 143 | Ga0466726_193374 | 3300042619 | Bacteria | 1796 |
| 144 | Ga0466728_217121 | 3300042620 | Bacteria | 4604 |
| 145 | Ga0264413_111441 | 3300024493 | Bacteria | 25463 |
| 146 | Ga0264413_111589 | 3300024493 | Bacteria | 1946 |
| 147 | Ga0466690_287614 | 3300042590 | Bacteria | 2398 |
| 148 | Ga0466696_438976 | 3300042596 | Bacteria | 1683 |
| 149 | Ga0466699_272685 | 3300042597 | Unclassified | 2340 |
| 150 | Ga0466713_130087 | 3300042602 | Bacteria | 2621 |
| 151 | Ga0466722_079090 | 3300042609 | Bacteria | 15903 |
| 152 | DPOL_contig19706 | 2035918003 | Bacteria | 59159 |
| 153 | Ga0068305_10037585 | 3300005083 | Bacteria | 1887 |
| 154 | Ga0072941_1001538 | 3300005201 | Bacteria | 43465 |
| 155 | Ga0072941_1053058 | 3300005201 | Bacteria | 6085 |
| 156 | Ga0072941_1283897 | 3300005201 | Bacteria | 1457 |
| 157 | Ga0466732_125209 | 3300042656 | Bacteria | 22857 |
| 158 | Ga0466703_246851 | 3300042636 | Bacteria | 41681 |
| 159 | Ga0466709_066299 | 3300042648 | Unclassified | 3044 |
| 160 | Ga0466709_086486 | 3300042648 | Bacteria | 2404 |
| 161 | Ga0466708_009540 | 3300042652 | Bacteria | 24875 |
| 162 | Ga0466708_128797 | 3300042652 | Bacteria | 13666 |
| 163 | Ga0466727_289895 | 3300042655 | Bacteria | 7440 |
| 164 | Ga0466711_167524 | 3300042615 | Bacteria | 4105 |
| 165 | Ga0466715_035122 | 3300042616 | Bacteria | 6761 |
| 166 | Ga0466715_294508 | 3300042616 | Bacteria | 5988 |
| 167 | Ga0466718_008046 | 3300042617 | Bacteria | 5919 |
| 168 | Ga0466718_064879 | 3300042617 | Bacteria | 8034 |
| 169 | Ga0466718_084801 | 3300042617 | Bacteria | 4727 |
| 170 | Ga0466723_076988 | 3300042618 | Bacteria | 6457 |
| 171 | Ga0466723_188108 | 3300042618 | Bacteria | 6170 |
| 172 | Ga0466726_017540 | 3300042619 | Unclassified | 4005 |
| 173 | Ga0466728_113659 | 3300042620 | Bacteria | 7329 |
| 174 | Ga0466692_068843 | 3300042591 | Bacteria | 2380 |
| 175 | Ga0466691_094428 | 3300042593 | Bacteria | 12490 |
| 176 | Ga0466696_226461 | 3300042596 | Bacteria | 89964 |
| 177 | Ga0466699_090317 | 3300042597 | Bacteria | 24950 |
| 178 | Ga0466699_133868 | 3300042597 | Archaea | 2235 |
| 179 | Ga0466706_265427 | 3300042599 | Bacteria | 2318 |
| 180 | Ga0466707_057153 | 3300042601 | Bacteria | 16347 |
| 181 | Ga0466707_088567 | 3300042601 | Bacteria | 1433 |
| 182 | Ga0466716_452134 | 3300042605 | Bacteria | 1858 |
| 183 | Ga0466719_061034 | 3300042606 | Bacteria | 12552 |
| 184 | DPOL_contig11357 | 2035918003 | Unclassified | 6497 |
| 185 | SPBB_contig09103 | 2044078006 | Bacteria | 56705 |
| 186 | SWWA_contig31645__length_38466___numreads_2230 | 2100351016 | Bacteria | 38466 |
| 187 | 2230969624 | 2228664004 | Bacteria | 9074 |
| 188 | AustNasuHG_c1017893 | 3300000089 | Bacteria | 2347 |
| 189 | Ga0466705_187583 | 3300042612 | Bacteria | 5986 |
| 190 | Ga0123353_10102000 | 3300010167 | Bacteria | 4626 |
| 191 | Ga0466704_430398 | 3300042643 | Bacteria | 5082 |
| 192 | Ga0466708_026494 | 3300042652 | Bacteria | 4773 |
| 193 | Ga0466708_269716 | 3300042652 | Bacteria | 44728 |
| 194 | Ga0466725_268142 | 3300042654 | Bacteria | 1599 |
| 195 | Ga0466727_225791 | 3300042655 | Bacteria | 2192 |
| 196 | Ga0466711_051710 | 3300042615 | Bacteria | 25077 |
| 197 | Ga0466711_053506 | 3300042615 | Bacteria | 11085 |
| 198 | Ga0466715_168792 | 3300042616 | Bacteria | 13370 |
| 199 | Ga0466715_518355 | 3300042616 | Unclassified | 1962 |
| 200 | Ga0466718_017279 | 3300042617 | Bacteria | 10247 |
| 201 | Ga0466723_299749 | 3300042618 | Unclassified | 6588 |
| 202 | Ga0160460_100497 | 3300012845 | Unclassified | 22938 |
| 203 | Ga0160445_108108 | 3300012847 | Unclassified | 1632 |
| 204 | Ga0466690_056476 | 3300042590 | Bacteria | 6847 |
| 205 | Ga0466694_172721 | 3300042594 | Unclassified | 1348 |
| 206 | Ga0466696_126735 | 3300042596 | Unclassified | 1247 |
| 207 | Ga0466696_133261 | 3300042596 | Bacteria | 7116 |
| 208 | Ga0466696_157453 | 3300042596 | Bacteria | 4882 |
| 209 | Ga0466696_241132 | 3300042596 | Bacteria | 6746 |
| 210 | Ga0466699_203574 | 3300042597 | Bacteria | 13311 |
| 211 | Ga0466699_231283 | 3300042597 | Bacteria | 3477 |
| 212 | Ga0466701_016497 | 3300042598 | Bacteria | 251596 |
| 213 | Ga0466716_348311 | 3300042605 | Bacteria | 3165 |
| 214 | Ga0466719_107925 | 3300042606 | Bacteria | 71556 |
| 215 | Ga0466720_031812 | 3300042607 | Bacteria | 7614 |
| 216 | Ga0466720_073587 | 3300042607 | Bacteria | 22083 |
| 217 | Ga0072941_1137391 | 3300005201 | Bacteria | 7645 |
| 218 | Ga0466705_063151 | 3300042612 | Unclassified | 1865 |
| 219 | Ga0466705_253976 | 3300042612 | Bacteria | 12442 |
| 220 | Ga0466705_320544 | 3300042612 | Bacteria | 4154 |
| 221 | Ga0123353_10153370 | 3300010167 | Bacteria | 3676 |
| 222 | Ga0466735_061483 | 3300042624 | Bacteria | 8819 |
| 223 | Ga0466735_231471 | 3300042624 | Bacteria | 2366 |
| 224 | Ga0466703_250643 | 3300042636 | Unclassified | 2751 |
| 225 | Ga0466704_017364 | 3300042643 | Bacteria | 3006 |
| 226 | Ga0466708_197790 | 3300042652 | Unclassified | 6212 |
| 227 | Ga0466708_456395 | 3300042652 | Bacteria | 1696 |
| 228 | Ga0466727_013877 | 3300042655 | Bacteria | 4257 |
| 229 | Ga0466711_171651 | 3300042615 | Bacteria | 1597 |
| 230 | Ga0466728_230414 | 3300042620 | Bacteria | 4090 |
| 231 | Ga0160443_101428 | 3300012848 | Unclassified | 8102 |
| 232 | Ga0160447_101274 | 3300012849 | Bacteria | 9965 |
| 233 | Ga0160435_1000609 | 3300012857 | Unclassified | 10543 |
| 234 | Ga0264413_109555 | 3300024493 | Unclassified | 5691 |
| 235 | Ga0466690_205334 | 3300042590 | Unclassified | 6025 |
| 236 | Ga0466691_132428 | 3300042593 | Bacteria | 8427 |
| 237 | Ga0466696_099987 | 3300042596 | Bacteria | 5907 |
| 238 | Ga0466696_321871 | 3300042596 | Bacteria | 8458 |
| 239 | Ga0466699_107752 | 3300042597 | Bacteria | 12714 |
| 240 | Ga0466699_117378 | 3300042597 | Bacteria | 9771 |
| 241 | Ga0466699_197390 | 3300042597 | Bacteria | 5155 |
| 242 | Ga0466699_281092 | 3300042597 | Bacteria | 3686 |
| 243 | Ga0466706_214194 | 3300042599 | Bacteria | 15640 |
| 244 | Ga0466700_264087 | 3300042600 | Bacteria | 1653 |
| 245 | Ga0466707_275235 | 3300042601 | Bacteria | 1828 |
| 246 | Ga0466719_055930 | 3300042606 | Bacteria | 2456 |
| 247 | Ga0466719_254448 | 3300042606 | Bacteria | 1984 |
| 248 | Ga0466719_395510 | 3300042606 | Bacteria | 3066 |
| 249 | Ga0466720_065106 | 3300042607 | Bacteria | 12854 |
| 250 | Ga0466722_085834 | 3300042609 | Bacteria | 4076 |
| 251 | Ga0466722_187951 | 3300042609 | Bacteria | 5645 |
| 252 | Meta3P_1009605 | 3300002464 | Unclassified | 3681 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02784 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.