Protein Family IF03958
Metagenome
Isolate
149
Members
110
Samples
94
Scaffolds
362.64
Avg Length
Representative Sequence
- ID
- 3300012847|Ga0160445_106421|Ga0160445_1064212
- Length
- 362 aa
- Sequence
- MSHNTFGHLFRVTTWGESHGPAIGCVVDGCPPLIPLTEADIQPWLDQRKPGGSRFVTQRQESDTARILSGVFDDGNGPVTTGTPISILIHNEDQRSRDYGEIARAFRPGHADYAYQAKYGVRDHRGGGRSSARETATRVAAGAIARRILGDAIRIRAGVVQIGPHRIAPDAVDFDAVGGNPLFAASSAVLPEWEAYLDGVRKAGSSIGAVVALEVTGVPAGWGAPLYGKLDAELAAALMSINAAKGVEIGAGFAAAELSGEANADEMRLDLNRQPVFLSNKAGGVLGGLSTGQPVTARVAFKPTSSILTPRQTITRDGEETDLRTKGRHDPCVALRAVPVVEAMAACVLADAMLRHRAQVG*
Sample Types
Isolate
36.9%
Metagenome
63.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
20.2%
Unclassified
14.7%
Termitidae
13.8%
Kalotermitidae
11.0%
Formicidae
10.1%
Aphididae
9.2%
Elmidae
5.5%
Armadillidiidae
4.6%
Culicidae
2.8%
Rhinotermitidae
2.8%
Termopsidae
1.8%
Cerambycidae
0.9%
Hodotermitidae
0.9%
Crambidae
0.9%
Drosophilidae
0.9%
Taxonomy
Archaea
0
Bacteria
144
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2846861257 | Buchnera aphidicola LSU | Isolate | Aphididae |
| 2 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 3 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 4 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 5 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 6 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 7 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 10 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 11 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 12 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 13 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 14 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 15 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 16 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 20 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 21 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 22 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 23 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 24 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 25 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 26 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 27 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 28 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 29 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 30 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 31 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 32 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 33 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 34 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 35 | 2884498641 | Buchnera aphidicola BuCicurvipes/3402 | Isolate | Aphididae |
| 36 | 2884500114 | Buchnera aphidicola BuCicuneomaculata/2628 | Isolate | Aphididae |
| 37 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 38 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 39 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 40 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 41 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 44 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 45 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 46 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 53 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 54 | 2511231158 | Buchnera aphidicola Ua | Isolate | Aphididae |
| 55 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 56 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 57 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 58 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 59 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 60 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 61 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 62 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 63 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 64 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 65 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 66 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 67 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 68 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 69 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 70 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 71 | 2884492481 | Buchnera aphidicola BuCicurtihirsuta/3053 | Isolate | Aphididae |
| 72 | 2884492905 | Buchnera aphidicola BuCipiceae/3303 | Isolate | Aphididae |
| 73 | 2884500535 | Buchnera aphidicola BuCilaricifoliae/3058 | Isolate | Aphididae |
| 74 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 75 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 76 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 77 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 78 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 79 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 80 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 81 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 82 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 83 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 84 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 85 | 2884499693 | Buchnera aphidicola BuCikochiana/2762 | Isolate | Aphididae |
| 86 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 87 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 88 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 89 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 90 | 639633012 | Buchnera aphidicola Bp | Isolate | Aphididae |
| 91 | 2843639003 | Buchnera aphidicola BuCistrobi/3249 | Isolate | Aphididae |
| 92 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 93 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 94 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 95 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 96 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 97 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 98 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 99 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 100 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 101 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 102 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 103 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 104 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 105 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 106 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 107 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 108 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 109 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 110 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10037798 | 3300009826 | Bacteria | 7851 |
| 2 | Ga0123356_10020901 | 3300010049 | Bacteria | 6191 |
| 3 | Ga0123356_10233286 | 3300010049 | Bacteria | 1906 |
| 4 | Ga0123354_10000029 | 3300010882 | Bacteria | 108162 |
| 5 | Ga0466722_059528 | 3300042609 | Bacteria | 3737 |
| 6 | Ga0466734_103526 | 3300042623 | Unclassified | 87559 |
| 7 | Ga0466704_468127 | 3300042643 | Bacteria | 3818 |
| 8 | JGI24702J35022_10010036 | 3300002462 | Bacteria | 5304 |
| 9 | CVPL005W_1000177 | 3300002934 | Bacteria | 50770 |
| 10 | CVPL005W_1000481 | 3300002934 | Bacteria | 34713 |
| 11 | Ga0103263_103019 | 3300007042 | Unclassified | 2039 |
| 12 | Ga0102738_1002132 | 3300007141 | Unclassified | 2979 |
| 13 | Ga0127524_100015 | 3300009478 | Bacteria | 633867 |
| 14 | Ga0466711_126392 | 3300042615 | Bacteria | 29897 |
| 15 | Ga0466723_263911 | 3300042618 | Bacteria | 9226 |
| 16 | Ga0466726_124955 | 3300042619 | Bacteria | 2722 |
| 17 | Ga0466726_225836 | 3300042619 | Bacteria | 1930 |
| 18 | Ga0123356_10016007 | 3300010049 | Bacteria | 7169 |
| 19 | Ga0466706_065220 | 3300042599 | Bacteria | 13272 |
| 20 | Ga0466704_241482 | 3300042643 | Bacteria | 2091 |
| 21 | Ga0466704_561171 | 3300042643 | Bacteria | 3166 |
| 22 | Ga0466724_60940 | 3300042649 | Bacteria | 1474 |
| 23 | Ga0466727_011744 | 3300042655 | Bacteria | 6729 |
| 24 | Ga0102736_1000487 | 3300007052 | Bacteria | 8287 |
| 25 | Ga0160470_100181 | 3300012813 | Bacteria | 56412 |
| 26 | Ga0466710_114442 | 3300042613 | Bacteria | 6906 |
| 27 | Ga0466710_375719 | 3300042613 | Bacteria | 1539 |
| 28 | Ga0466728_340533 | 3300042620 | Bacteria | 3447 |
| 29 | Ga0466729_243623 | 3300042621 | Bacteria | 3875 |
| 30 | Ga0466734_028347 | 3300042623 | Bacteria | 4607 |
| 31 | Ga0466734_066765 | 3300042623 | Bacteria | 8550 |
| 32 | Ga0466703_202420 | 3300042636 | Bacteria | 8876 |
| 33 | Ga0466725_122565 | 3300042654 | Bacteria | 38170 |
| 34 | Ga0466725_205497 | 3300042654 | Bacteria | 2957 |
| 35 | CVPL010W_10017485 | 3300002931 | Bacteria | 5840 |
| 36 | Ga0160469_100118 | 3300012824 | Bacteria | 111072 |
| 37 | Ga0160435_1000002 | 3300012857 | Bacteria | 505104 |
| 38 | Ga0160457_1002174 | 3300012858 | Unclassified | 4339 |
| 39 | Ga0466657_082505 | 3300042582 | Bacteria | 18827 |
| 40 | Ga0466690_065424 | 3300042590 | Bacteria | 36052 |
| 41 | Ga0466691_180576 | 3300042593 | Bacteria | 6487 |
| 42 | Ga0123355_10639667 | 3300009826 | Unclassified | 1246 |
| 43 | Ga0466709_039602 | 3300042648 | Bacteria | 7660 |
| 44 | Ga0466725_150948 | 3300042654 | Bacteria | 53167 |
| 45 | Ga0466725_321878 | 3300042654 | Bacteria | 1838 |
| 46 | CVPL010W_10004041 | 3300002931 | Bacteria | 24346 |
| 47 | Ga0103265_1001992 | 3300007068 | Bacteria | 3201 |
| 48 | Ga0160435_1000083 | 3300012857 | Bacteria | 57275 |
| 49 | Ga0466710_381390 | 3300042613 | Bacteria | 32855 |
| 50 | Ga0123355_10220229 | 3300009826 | Bacteria | 2731 |
| 51 | Ga0123353_10013509 | 3300010167 | Bacteria | 11702 |
| 52 | Ga0466707_165317 | 3300042601 | Bacteria | 1720 |
| 53 | Ga0466716_278362 | 3300042605 | Bacteria | 14360 |
| 54 | Ga0466708_154825 | 3300042652 | Bacteria | 3430 |
| 55 | Ga0466708_204477 | 3300042652 | Bacteria | 15636 |
| 56 | Ga0466708_352635 | 3300042652 | Bacteria | 2697 |
| 57 | Ga0466725_037252 | 3300042654 | Bacteria | 45444 |
| 58 | Ga0466725_421746 | 3300042654 | Bacteria | 2260 |
| 59 | Ga0104044_1146450 | 3300007136 | Bacteria | 2678 |
| 60 | Ga0466692_033632 | 3300042591 | Bacteria | 31831 |
| 61 | Ga0466695_343973 | 3300042595 | Bacteria | 2247 |
| 62 | Ga0466697_173538 | 3300042611 | Bacteria | 4400 |
| 63 | Ga0466710_269365 | 3300042613 | Bacteria | 7173 |
| 64 | Ga0466726_067098 | 3300042619 | Bacteria | 3678 |
| 65 | Ga0466706_152882 | 3300042599 | Bacteria | 22861 |
| 66 | Ga0466719_047024 | 3300042606 | Bacteria | 3887 |
| 67 | Ga0466708_440413 | 3300042652 | Bacteria | 8144 |
| 68 | Ga0102739_1000385 | 3300007095 | Bacteria | 9528 |
| 69 | Ga0102740_1003323 | 3300007140 | Bacteria | 3476 |
| 70 | Ga0103264_1000078 | 3300007188 | Bacteria | 147291 |
| 71 | Ga0123357_10000046 | 3300009784 | Bacteria | 99884 |
| 72 | Ga0466691_142634 | 3300042593 | Bacteria | 8807 |
| 73 | Ga0466710_161518 | 3300042613 | Bacteria | 1670 |
| 74 | Ga0466715_310150 | 3300042616 | Bacteria | 13977 |
| 75 | Ga0123354_10006388 | 3300010882 | Bacteria | 17495 |
| 76 | Ga0466701_068613 | 3300042598 | Bacteria | 30748 |
| 77 | Ga0466725_047312 | 3300042654 | Bacteria | 3005 |
| 78 | Ga0102738_1000133 | 3300007141 | Bacteria | 21430 |
| 79 | Ga0103264_1001357 | 3300007188 | Bacteria | 14992 |
| 80 | Ga0160445_106421 | 3300012847 | Bacteria | 1921 |
| 81 | Ga0160436_1000155 | 3300012861 | Bacteria | 34463 |
| 82 | Ga0466701_030460 | 3300042598 | Bacteria | 6990 |
| 83 | Ga0466708_190700 | 3300042652 | Bacteria | 29705 |
| 84 | Ga0103260_1000747 | 3300007139 | Bacteria | 6080 |
| 85 | Ga0102740_1000280 | 3300007140 | Bacteria | 31708 |
| 86 | Ga0102737_1000007 | 3300007142 | Bacteria | 71987 |
| 87 | Ga0102737_1000234 | 3300007142 | Bacteria | 18842 |
| 88 | Ga0103264_1000067 | 3300007188 | Bacteria | 62974 |
| 89 | Ga0160433_100010 | 3300012846 | Bacteria | 293456 |
| 90 | Ga0160443_100007 | 3300012848 | Bacteria | 631542 |
| 91 | Ga0466657_015947 | 3300042582 | Bacteria | 203876 |
| 92 | Ga0466657_354690 | 3300042582 | Bacteria | 3382 |
| 93 | Ga0466657_390823 | 3300042582 | Bacteria | 58911 |
| 94 | Ga0466693_317855 | 3300042592 | Bacteria | 6673 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01264 | Chorismate_synt | Chorismate synthase | 10 | 354 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.