Protein Family IF03827

Metagenome Isolate
226 Members
174 Samples
112 Scaffolds
345.03 Avg Length

🧬 Representative Sequence

ID
3300012837|Ga0160455_100019|Ga0160455_100019225
Length
337 aa
Sequence
MSISYTDALTRCIEHREIFHDEMLYLMRQLMRGEVPPPIASALLMGLRVKKETIGEITAAATVMREFATPVSISDPDNLLDMCGTGGDASHTFNISTTAMFVAAAGGVRIAKHGNRSSXXXXGSADVLEALGINVMLSPEQVAECVEFAPAHHGSMKNVAEIRKMLAVRTIFNILGPLTNPAKAGNQLMGVFHPDLVGIQVRVLQQLGSKHVLIVHGKDNLDEASLGAATLVGELKDGKVSEYEIHPEDFGMQMVSIRNITVSNKEESRDLVMSALNNEAGTARDIVMLNAGLALYAGNQAASMQDGINKARELIQSGAARDKLETFRAYTRKLTT*

📊 Sample Types

Isolate 50.4%
Metagenome 49.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 46.8%
Formicidae 10.5%
Termitidae 9.9%
Unclassified 7.0%
Kalotermitidae 4.7%
Elmidae 4.1%
Culicidae 4.1%
Rhinotermitidae 1.8%
Curculionidae 1.8%
Armadillidiidae 1.8%
Largidae 1.2%
Hydrophilidae 1.2%
Berytidae 1.2%
Alydidae 1.2%
Hodotermitidae 0.6%
Cixiidae 0.6%
Termopsidae 0.6%
Crambidae 0.6%
Drosophilidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 208
Eukaryota 0
Viruses 0
Unclassified 18

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
2 2864755708 Massilia timonae S00006 Isolate Elmidae
3 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
4 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
5 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
10 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
11 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
12 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
13 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
14 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
15 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
16 8100455565 Delftia sp. S67 Isolate Curculionidae
17 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
18 8102102351 Caballeronia sp. INML1 Isolate Coreidae
19 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
20 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
21 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
24 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
25 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
26 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
27 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
28 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
29 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
32 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
33 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
34 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
35 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
36 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
37 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
38 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
39 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
40 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
41 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
42 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
43 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
44 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
45 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
46 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
47 2820132692 Unclassified Proteobacteria Emb289P3bin76 Isolate Unclassified
48 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
49 2864937364 Acidovorax soli S00198 Isolate Elmidae
50 2963630348 Burkholderiales bacterium 3487_49 Isolate Formicidae
51 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
52 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
53 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
54 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
55 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
56 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
57 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
58 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
59 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
60 8102117041 Caballeronia sp. INML3 Isolate Coreidae
61 8102131453 Caballeronia sp. INML5 Isolate Coreidae
62 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
63 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
64 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
65 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
66 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
67 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
68 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
69 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
70 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
71 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
72 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
73 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
74 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
75 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
76 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
77 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
78 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
79 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
80 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
81 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
82 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
83 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
84 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
85 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
86 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
87 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
88 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
89 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
90 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
91 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
92 2868169047 Comamonas aquatica S00077 Isolate Elmidae
93 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
94 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
95 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
96 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
97 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
98 8023757577 Caballeronia peredens LP006 Isolate Coreidae
99 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
100 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
101 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
102 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
103 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
104 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
105 8100461708 Delftia sp. S65 Isolate Curculionidae
106 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
107 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
108 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
109 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
110 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
111 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
112 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
113 2838140227 Dyella sp. OAE510 Isolate Unclassified
114 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
115 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
116 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
117 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
118 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
119 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
120 8069748016 Caballeronia sp. LP003 Isolate Coreidae
121 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
122 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
123 8102109360 Caballeronia sp. INML2 Isolate Coreidae
124 8102145433 Caballeronia sp. LP006 Isolate Coreidae
125 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
126 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
127 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
128 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
129 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
130 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
131 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
132 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
133 2603880165 Burkholderiales A1 Isolate Unclassified
134 2603880170 Burkholderiales A2 Isolate Unclassified
135 2603880172 Burkholderiales C Isolate Unclassified
136 2617270844 Dyella sp. HyOG Isolate Cixiidae
137 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
138 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
139 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
140 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
141 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
142 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
143 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
144 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
145 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
146 8102124461 Caballeronia sp. INML3B Isolate Coreidae
147 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
148 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
149 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
150 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
151 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
152 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
153 2820071837 Unclassified Proteobacteria Nt197P3bin132 Isolate Unclassified
154 2834230000 Pandoraea novymonadis E262 Isolate Unclassified
155 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
156 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
157 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
158 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
159 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
160 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
161 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
162 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
163 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
164 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
165 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
166 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
167 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
168 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
169 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
170 8100449422 Delftia sp. S66 Isolate Curculionidae
171 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
172 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
173 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
174 8102271933 Caballeronia sp. NCF4 Isolate Coreidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160440_100012 3300012815 Bacteria 357729
2 Ga0466694_252101 3300042594 Bacteria 7276
3 Ga0466730_058094 3300042625 Bacteria 27975
4 Ga0466730_101856 3300042625 Unclassified 87029
5 Ga0466704_438718 3300042643 Bacteria 22312
6 Ga0466725_256350 3300042654 Bacteria 3922
7 Ga0123354_10172584 3300010882 Bacteria 2508
8 Ga0160471_101503 3300012812 Unclassified 4539
9 Ga0466701_026441 3300042598 Bacteria 4717
10 Ga0466722_022053 3300042609 Bacteria 4564
11 Ga0466722_239257 3300042609 Bacteria 3767
12 CVPL010W_10001630 3300002931 Bacteria 28397
13 Ga0103263_100166 3300007042 Bacteria 10840
14 Ga0103265_1006309 3300007068 Bacteria 1602
15 Ga0103264_1000510 3300007188 Bacteria 36323
16 Ga0103264_1001088 3300007188 Bacteria 12084
17 Ga0103267_1000135 3300007190 Bacteria 28536
18 Ga0466729_133043 3300042621 Bacteria 6053
19 Ga0160441_100002 3300012825 Bacteria 856781
20 Ga0160436_1001418 3300012861 Bacteria 6554
21 Ga0466730_091386 3300042625 Bacteria 123631
22 Ga0466704_132570 3300042643 Bacteria 3487
23 Ga0466704_180544 3300042643 Bacteria 1981
24 Ga0466725_004532 3300042654 Bacteria 2157
25 Ga0466701_035643 3300042598 Bacteria 136603
26 Ga0466701_065200 3300042598 Bacteria 96098
27 Ga0466722_139781 3300042609 Bacteria 3673
28 CVPL010W_10000621 3300002931 Bacteria 39342
29 Ga0102736_1000022 3300007052 Bacteria 138148
30 Ga0102734_1016046 3300007129 Bacteria 3620
31 Ga0102738_1000138 3300007141 Bacteria 20799
32 Ga0466703_366607 3300042636 Bacteria 10944
33 Ga0466708_068246 3300042652 Bacteria 17029
34 Ga0466708_443700 3300042652 Bacteria 5187
35 Ga0160466_103024 3300012809 Unclassified 2967
36 Ga0466700_262925 3300042600 Bacteria 2565
37 Ga0103261_1000925 3300007083 Bacteria 4536
38 Ga0103264_1000170 3300007188 Bacteria 41856
39 Ga0123357_10000189 3300009784 Bacteria 57563
40 Ga0466705_094022 3300042612 Bacteria 13044
41 Ga0160455_100019 3300012837 Bacteria 453457
42 Ga0160460_101695 3300012845 Bacteria 6621
43 Ga0466657_342691 3300042582 Bacteria 3884
44 Ga0466693_190353 3300042592 Bacteria 2003
45 Ga0466734_021292 3300042623 Bacteria 2453
46 Ga0466734_040490 3300042623 Bacteria 6625
47 Ga0123354_10000108 3300010882 Bacteria 61441
48 Ga0466701_097363 3300042598 Bacteria 17178
49 Ga0466706_119955 3300042599 Bacteria 3373
50 Ga0466716_462401 3300042605 Bacteria 4440
51 Ga0466719_348798 3300042606 Bacteria 13241
52 Ga0466719_388452 3300042606 Bacteria 3416
53 CVPL005W_1000477 3300002934 Bacteria 30886
54 Ga0103261_1004600 3300007083 Bacteria 2067
55 Ga0102740_1000009 3300007140 Bacteria 106515
56 Ga0103264_1001198 3300007188 Bacteria 11483
57 Ga0160472_100483 3300012839 Bacteria 27180
58 Ga0466691_009244 3300042593 Bacteria 3809
59 Ga0466704_292345 3300042643 Bacteria 3095
60 Ga0466724_27476 3300042649 Bacteria 555291
61 Ga0466725_177968 3300042654 Bacteria 5674
62 Ga0123356_10042525 3300010049 Bacteria 4232
63 Ga0466701_074302 3300042598 Unclassified 68083
64 Ga0103266_1000870 3300007067 Unclassified 5488
65 Ga0102739_1000013 3300007095 Bacteria 65151
66 Ga0104049_1003875 3300007103 Bacteria 2912
67 Ga0102737_1002206 3300007142 Unclassified 4936
68 Ga0103268_1000025 3300007192 Bacteria 63089
69 Ga0466711_504964 3300042615 Bacteria 13845
70 Ga0466697_109022 3300042611 Bacteria 1408
71 Ga0160470_100236 3300012813 Unclassified 42375
72 Ga0160459_100048 3300012831 Bacteria 189455
73 Ga0160435_1004991 3300012857 Unclassified 3038
74 Ga0466695_209132 3300042595 Bacteria 2335
75 Ga0466704_433222 3300042643 Bacteria 27622
76 Ga0466725_073706 3300042654 Bacteria 3591
77 Ga0466701_100222 3300042598 Bacteria 3538
78 CVPL010W_10001850 3300002931 Bacteria 24973
79 Ga0103261_1000076 3300007083 Bacteria 24644
80 Ga0103260_1000166 3300007139 Bacteria 14833
81 Ga0466705_503405 3300042612 Unclassified 2700
82 Ga0466710_438773 3300042613 Bacteria 6845
83 Ga0466718_088309 3300042617 Bacteria 6446
84 Ga0466726_106886 3300042619 Bacteria 14812
85 Ga0466733_182496 3300042659 Bacteria 4696
86 Ga0160469_104097 3300012824 Unclassified 1789
87 Ga0160444_100360 3300012841 Bacteria 25877
88 Ga0466730_063557 3300042625 Bacteria 5657
89 Ga0466704_052861 3300042643 Unclassified 26444
90 Ga0123354_10117595 3300010882 Bacteria 3459
91 Ga0466701_086004 3300042598 Unclassified 65793
92 CVPL010W_10010034 3300002931 Bacteria 8353
93 Ga0102740_1001153 3300007140 Bacteria 12349
94 Ga0102740_1003475 3300007140 Unclassified 3364
95 Ga0102738_1000024 3300007141 Bacteria 99972
96 Ga0102738_1001643 3300007141 Unclassified 3450
97 Ga0103268_1002064 3300007192 Bacteria 4633
98 Ga0466710_443230 3300042613 Bacteria 99469
99 Ga0466705_024505 3300042612 Bacteria 12587
100 Ga0160440_100210 3300012815 Bacteria 44461
101 Ga0160472_102927 3300012839 Unclassified 3604
102 Ga0160435_1005218 3300012857 Bacteria 2964
103 Ga0466657_053073 3300042582 Bacteria 114727
104 Ga0466701_005431 3300042598 Bacteria 3573
105 Ga0466734_078578 3300042623 Bacteria 5648
106 Ga0466716_512023 3300042605 Bacteria 3039
107 CVPL010W_10004115 3300002931 Bacteria 16318
108 CVPL005W_1000325 3300002934 Unclassified 26144
109 CVPL005L_10000120 3300002938 Bacteria 58757
110 Ga0103263_100928 3300007042 Unclassified 3917
111 Ga0102736_1002072 3300007052 Unclassified 5194
112 Ga0103264_1002278 3300007188 Bacteria 8616

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain 78 320 0.99
PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain 7 68 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00591 GO:0016757 glycosyltransferase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.