Protein Family IF03757
Metagenome
Metatranscriptome
Isolate
174
Members
134
Samples
113
Scaffolds
360.4
Avg Length
Representative Sequence
- ID
- 3300012829|Ga0160467_102225|Ga0160467_1022252
- Length
- 414 aa
- Sequence
- MDVNDDAGFLIKRDVFESIASKLAPTVDRASHTRDDHTVLLRDYHQIRARLDVSKRAYNFCAGPAALPEAVLKRAQGELLDWHGKGLSVMEMSHRSDEFVSIATKAEQDLRDLLNIPSNYKVLFLQGGASQQFAQIPLNLLPENGTADYIDTGIWSQKAIEEASRYGHVNVAGTAKPYDYFAIPGQNEWKLSKDASYVHYAPNETIGGLEFQWVPETGDVPLVADMSSDILSRPIDVSRFGMIYAGAQKNIGPSGIVVNIVREDLLGRARSLCPTMLDYKVAADNGSMYNTPPTLAWYLSGLVFEWLKEQGGVEAIGKLNEVKQRTLYEFIDASGLYSNPINKSDRSWMNVPFRLADDRLDKPFLAGAEERGLLNLKGHRSVGGMRASIYNAVDIVAVNALISYMAEFEKEHG*
Sample Types
Isolate
35.1%
Metagenome
63.2%
MAG
0.0%
Metatranscriptome
1.7%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
19.2%
Termitidae
15.2%
Kalotermitidae
11.2%
Formicidae
8.0%
Drosophilidae
7.2%
Curculionidae
7.2%
Elmidae
5.6%
Aphididae
4.8%
Culicidae
4.8%
Armadillidiidae
4.0%
Rhinotermitidae
2.4%
Termopsidae
2.4%
Apidae
1.6%
Lysianassidae
0.8%
Tenebrionidae
0.8%
Hodotermitidae
0.8%
Siricidae
0.8%
Gryllidae
0.8%
Sarcophagidae
0.8%
Trigoniulidae
0.8%
Noctuidae
0.8%
Taxonomy
Archaea
0
Bacteria
161
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 2 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 3 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 4 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 5 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 6 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 9 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 10 | 3300021227 | Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA | Metatranscriptome | Termitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 13 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 14 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 3300038763 | Termite gut microbial communities of Labiotermes labralis from French Guiana - 62_rP2 | Metatranscriptome | Termitidae |
| 17 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 18 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 19 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 20 | 2558860195 | Buchnera aphidicola G002 | Isolate | Aphididae |
| 21 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 22 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 23 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 26 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 27 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 28 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 33 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 36 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 39 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 42 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 43 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 44 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 45 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 46 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 47 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 48 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 49 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 50 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 51 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 52 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 53 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 54 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 55 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 56 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 57 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 58 | 2511231206 | Buchnera aphidicola Ak | Isolate | Aphididae |
| 59 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 60 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 61 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 62 | 3300009482 | Microbial communities of aphids from from Chrysanthemum sp. in New Haven, CT, USA - Macrosiphoniella sanborni NM102210_03 seqcov | Metagenome | |
| 63 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 64 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 65 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 66 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 67 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 68 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 69 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 70 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 71 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 72 | 2820219087 | Unclassified Ignavibacteria Th196P3bin14 | Isolate | Unclassified |
| 73 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 74 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 75 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 76 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 77 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 78 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 79 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 80 | 2558860196 | Buchnera aphidicola W106 | Isolate | Aphididae |
| 81 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 82 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 83 | 2984883310 | Serratia symbiotica SCifornacula/2912 | Isolate | Aphididae |
| 84 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 85 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 86 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 87 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 88 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 89 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 90 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 91 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 92 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 93 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 94 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 95 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 96 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 97 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 98 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 99 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 100 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 101 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 102 | 2558860197 | Buchnera aphidicola F009 | Isolate | Aphididae |
| 103 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 104 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 105 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 106 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 107 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 108 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 109 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 110 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 111 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 112 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 113 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 114 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 115 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 116 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 117 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 118 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 119 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 120 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 121 | 2558860194 | Buchnera aphidicola USDA | Isolate | Aphididae |
| 122 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 123 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 124 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 125 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 126 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 127 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 128 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 129 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 130 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 131 | 3300021231 | Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA | Metatranscriptome | Termitidae |
| 132 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 133 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 134 | 8035422605 | Pseudomonas monteilii CY06 | Isolate |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123354_10000003 | 3300010882 | Bacteria | 303062 |
| 2 | Ga0466711_005366 | 3300042615 | Bacteria | 4625 |
| 3 | Ga0466701_055000 | 3300042598 | Bacteria | 242806 |
| 4 | Ga0466701_080182 | 3300042598 | Unclassified | 3270 |
| 5 | Ga0466707_037867 | 3300042601 | Unclassified | 3052 |
| 6 | Ga0466719_155407 | 3300042606 | Bacteria | 4181 |
| 7 | Ga0160431_101918 | 3300012828 | Bacteria | 5334 |
| 8 | Ga0160467_102225 | 3300012829 | Bacteria | 4699 |
| 9 | Ga0160458_101065 | 3300012832 | Unclassified | 6558 |
| 10 | Ga0466691_216068 | 3300042593 | Bacteria | 7613 |
| 11 | Ga0466696_447640 | 3300042596 | Bacteria | 7212 |
| 12 | Ga0072941_1153183 | 3300005201 | Bacteria | 12092 |
| 13 | Ga0102735_1019425 | 3300007080 | Bacteria | 1695 |
| 14 | Ga0103268_1000214 | 3300007192 | Bacteria | 19061 |
| 15 | Ga0466703_217768 | 3300042636 | Bacteria | 2266 |
| 16 | Ga0466704_101637 | 3300042643 | Unclassified | 51587 |
| 17 | Ga0466724_35745 | 3300042649 | Bacteria | 11027 |
| 18 | Ga0466715_220926 | 3300042616 | Bacteria | 22660 |
| 19 | Ga0466715_368021 | 3300042616 | Bacteria | 6779 |
| 20 | Ga0466723_006555 | 3300042618 | Bacteria | 28229 |
| 21 | Ga0466722_090824 | 3300042609 | Bacteria | 2084 |
| 22 | Ga0466722_144255 | 3300042609 | Bacteria | 15561 |
| 23 | Ga0160460_103702 | 3300012845 | Unclassified | 2594 |
| 24 | Ga0102736_1001735 | 3300007052 | Bacteria | 3687 |
| 25 | Ga0103266_1000055 | 3300007067 | Bacteria | 76804 |
| 26 | Ga0102734_1012380 | 3300007129 | Bacteria | 3052 |
| 27 | Ga0104019_1002935 | 3300007150 | Bacteria | 11868 |
| 28 | Ga0466734_088063 | 3300042623 | Bacteria | 7169 |
| 29 | Ga0466703_005370 | 3300042636 | Bacteria | 1208 |
| 30 | Ga0466704_178263 | 3300042643 | Bacteria | 3163 |
| 31 | Ga0466704_363902 | 3300042643 | Bacteria | 140929 |
| 32 | Ga0466709_073268 | 3300042648 | Bacteria | 13476 |
| 33 | Ga0466709_124044 | 3300042648 | Bacteria | 2236 |
| 34 | Ga0466708_106595 | 3300042652 | Bacteria | 59435 |
| 35 | Ga0466725_176106 | 3300042654 | Bacteria | 50141 |
| 36 | Ga0466727_102596 | 3300042655 | Bacteria | 2994 |
| 37 | Ga0466732_043598 | 3300042656 | Bacteria | 56649 |
| 38 | Ga0123354_10047874 | 3300010882 | Bacteria | 6509 |
| 39 | Ga0466705_234594 | 3300042612 | Bacteria | 119076 |
| 40 | Ga0466723_153528 | 3300042618 | Bacteria | 11203 |
| 41 | Ga0466701_022173 | 3300042598 | Bacteria | 77061 |
| 42 | Ga0466701_091826 | 3300042598 | Bacteria | 124406 |
| 43 | Ga0466713_045375 | 3300042602 | Bacteria | 2449 |
| 44 | Ga0466716_325940 | 3300042605 | Bacteria | 6498 |
| 45 | Ga0466691_156410 | 3300042593 | Bacteria | 5176 |
| 46 | SPBB_contig11510 | 2044078006 | Bacteria | 168387 |
| 47 | FGTW_contig30438 | 2065487013 | Bacteria | 39641 |
| 48 | SWWA_contig31754__length_9284___numreads_548 | 2100351016 | Bacteria | 9284 |
| 49 | JGI24703J35330_11748524 | 3300002501 | Bacteria | 18606 |
| 50 | Ga0466735_204791 | 3300042624 | Bacteria | 2637 |
| 51 | Ga0466730_062424 | 3300042625 | Bacteria | 14474 |
| 52 | Ga0466705_189143 | 3300042612 | Bacteria | 1496 |
| 53 | Ga0466705_230967 | 3300042612 | Bacteria | 25847 |
| 54 | Ga0160433_100383 | 3300012846 | Bacteria | 24942 |
| 55 | Ga0160447_102075 | 3300012849 | Bacteria | 7293 |
| 56 | Ga0160436_1000955 | 3300012861 | Bacteria | 8731 |
| 57 | Ga0223688_1023517 | 3300021227 | Unclassified | 1136 |
| 58 | Ga0399895_011574 | 3300038763 | Unclassified | 1754 |
| 59 | Ga0466692_168844 | 3300042591 | Bacteria | 18445 |
| 60 | Ga0466691_210014 | 3300042593 | Bacteria | 3447 |
| 61 | DPOL_contig00143 | 2035918003 | Bacteria | 8155 |
| 62 | Ga0102737_1001457 | 3300007142 | Bacteria | 6575 |
| 63 | Ga0103267_1005107 | 3300007190 | Bacteria | 3641 |
| 64 | Ga0466709_035226 | 3300042648 | Bacteria | 2276 |
| 65 | Ga0466708_138748 | 3300042652 | Bacteria | 3013 |
| 66 | Ga0123357_10087722 | 3300009784 | Bacteria | 4069 |
| 67 | Ga0466705_348975 | 3300042612 | Bacteria | 2423 |
| 68 | Ga0466705_453736 | 3300042612 | Bacteria | 30628 |
| 69 | Ga0466726_287512 | 3300042619 | Bacteria | 2745 |
| 70 | Ga0466728_110044 | 3300042620 | Bacteria | 4528 |
| 71 | Ga0466706_220212 | 3300042599 | Bacteria | 3761 |
| 72 | Ga0160469_101616 | 3300012824 | Unclassified | 5551 |
| 73 | Ga0466690_356202 | 3300042590 | Bacteria | 10995 |
| 74 | JGI24702J35022_10001117 | 3300002462 | Bacteria | 16662 |
| 75 | Meta3P_1000273 | 3300002464 | Unclassified | 41050 |
| 76 | Ga0466729_249412 | 3300042621 | Bacteria | 1469 |
| 77 | Ga0466730_037212 | 3300042625 | Bacteria | 2617 |
| 78 | Ga0466709_221156 | 3300042648 | Bacteria | 11787 |
| 79 | Ga0466725_152994 | 3300042654 | Bacteria | 69484 |
| 80 | Ga0466733_033112 | 3300042659 | Bacteria | 1406 |
| 81 | Ga0123357_10072773 | 3300009784 | Bacteria | 4553 |
| 82 | Ga0466705_505529 | 3300042612 | Unclassified | 2745 |
| 83 | Ga0466715_183395 | 3300042616 | Unclassified | 5302 |
| 84 | Ga0466723_232840 | 3300042618 | Bacteria | 2473 |
| 85 | Ga0466728_331867 | 3300042620 | Bacteria | 1801 |
| 86 | Ga0466714_026523 | 3300042603 | Bacteria | 4604 |
| 87 | Ga0466690_261298 | 3300042590 | Bacteria | 57876 |
| 88 | CVPL005W_1000091 | 3300002934 | Bacteria | 39163 |
| 89 | Ga0074188_1039581 | 3300005318 | Bacteria | 3953 |
| 90 | Ga0103264_1000001 | 3300007188 | Bacteria | 204769 |
| 91 | Ga0466703_037802 | 3300042636 | Bacteria | 4874 |
| 92 | Ga0466724_67921 | 3300042649 | Bacteria | 67072 |
| 93 | Ga0123353_10911642 | 3300010167 | Bacteria | 1195 |
| 94 | Ga0466715_378380 | 3300042616 | Bacteria | 15131 |
| 95 | Ga0466723_164753 | 3300042618 | Bacteria | 1335 |
| 96 | Ga0466726_056969 | 3300042619 | Bacteria | 8626 |
| 97 | Ga0160432_101790 | 3300012818 | Unclassified | 5911 |
| 98 | Ga0160456_101292 | 3300012820 | Bacteria | 6112 |
| 99 | Ga0160443_106896 | 3300012848 | Bacteria | 1444 |
| 100 | CVPL010W_10016444 | 3300002931 | Bacteria | 5219 |
| 101 | Ga0127527_100222 | 3300009482 | Bacteria | 203775 |
| 102 | Ga0466709_408360 | 3300042648 | Bacteria | 4076 |
| 103 | Ga0562374_0136 | 3300057007 | Bacteria | 182707 |
| 104 | Ga0123356_10110011 | 3300010049 | Bacteria | 2660 |
| 105 | Ga0123353_10436900 | 3300010167 | Bacteria | 1932 |
| 106 | Ga0466710_413939 | 3300042613 | Bacteria | 1778 |
| 107 | Ga0466715_513940 | 3300042616 | Bacteria | 1840 |
| 108 | Ga0466729_075285 | 3300042621 | Bacteria | 31754 |
| 109 | Ga0466707_109896 | 3300042601 | Bacteria | 2218 |
| 110 | Ga0223682_1022281 | 3300021231 | Unclassified | 1367 |
| 111 | Ga0466657_189892 | 3300042582 | Bacteria | 57371 |
| 112 | Ga0466692_169654 | 3300042591 | Bacteria | 21508 |
| 113 | Ga0466734_053344 | 3300042623 | Bacteria | 92534 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00266 | Aminotran_5 | Aminotransferase class-V | 58 | 399 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.