Protein Family IF03678
Metagenome
Isolate
212
Members
127
Samples
144
Scaffolds
569.7
Avg Length
Representative Sequence
- ID
- 3300012818|Ga0160432_100004|Ga0160432_100004192
- Length
- 612 aa
- Sequence
- MGDWNRREWIKVVGMSALGTVVGLRKLGLDASSVKYIDGELYIPRAKYVALFGPTTGDKVRLADTELFIEIEKDFAVYGEENKFGGGKTIRDGMGQSARALGDEGVLDFCITNVIVIDHWGIVKGDVGIKSGKIVGVGKAGNPDVQDGVSEGMIIGASTEVHSGAGMILTAGGIDTHIHFISPQQVETALYSGVTTFIGGGTGPADGSNATTVTSGKWYIEKMLQAFETLPINVGIFGKGNVSTMRPIEEMVEAGALGVKIHEDWGATPVTIDTALKVADKYDVQVAIHSDTLNEAGFLEDTVRAIDGRVIHTFHTEGAGGGHAPDIIKIAMYPNILPASTNPTKPYTVNTAEEHLDMLMVCHHLDKNVKEDVAFADSRIRPQTIAAEDILQDMGVFSIMSSDSQAMGRVGEVISRTFQTAHKMKIQRGPLKEDEGSGNDNFRVKRYVSKYTINPAKAHGIDTYVGSIEPGKYADLILWKAEMFGVKPELIIKGGMILGAKMGDINASIPTPQPIVYRMMFGNYGKALSNICYNFVSKISLENGSIKKMGLSRTSLPVKGCRTVMKKDMVHNNATPDITVDPETYDVKVDGVIATCEPLAVLPMAQRYFLF*
Sample Types
Isolate
32.1%
Metagenome
67.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
32.8%
Termitidae
11.8%
Unclassified
10.9%
Kalotermitidae
9.2%
Tenebrionidae
5.0%
Rhinotermitidae
4.2%
Drosophilidae
3.4%
Blattidae
3.4%
Culicidae
2.5%
Hydrophilidae
1.7%
Bombycidae
1.7%
Armadillidiidae
1.7%
Formicidae
1.7%
Elmidae
1.7%
Pyralidae
1.7%
Noctuidae
0.8%
Anthocoridae
0.8%
Curculionidae
0.8%
Daphniidae
0.8%
Siricidae
0.8%
Cixiidae
0.8%
Termopsidae
0.8%
Muscidae
0.8%
Taxonomy
Archaea
0
Bacteria
183
Eukaryota
0
Viruses
0
Unclassified
29
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 2 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 3 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 4 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 5 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 6 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 11 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 12 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 13 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 18 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 19 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 20 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 21 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 22 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 23 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 24 | 3300000479 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-P14 | Metagenome | Apidae |
| 25 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 26 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 27 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 28 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 29 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 30 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 35 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 36 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 37 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 38 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 39 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 40 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 41 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 42 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 43 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 44 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 45 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 46 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 47 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 48 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 51 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 52 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 53 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 54 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 55 | 2864985977 | Staphylococcus hominis S00278 | Isolate | Elmidae |
| 56 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 57 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 58 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 59 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 60 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 61 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 62 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 63 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 64 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 65 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 66 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 67 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 68 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 69 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 70 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 71 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 72 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 73 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 74 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 75 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 76 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 77 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 78 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 79 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 80 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 81 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 82 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 83 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 84 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 85 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 86 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 87 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 88 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 89 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 90 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 91 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 92 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 93 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 94 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 95 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 96 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 97 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 98 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 99 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 100 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 101 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 102 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 103 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 104 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 105 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 106 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 107 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 108 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 109 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 110 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 111 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 112 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 113 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 114 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 115 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 116 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 117 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 118 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 119 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 120 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 121 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 122 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 123 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 124 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 125 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 126 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 127 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_083610 | 3300042659 | Bacteria | 33057 |
| 2 | Ga0466707_138798 | 3300042601 | Bacteria | 3187 |
| 3 | Ga0466719_255482 | 3300042606 | Bacteria | 15289 |
| 4 | Ga0160453_100006 | 3300012814 | Bacteria | 353163 |
| 5 | Ga0160455_101856 | 3300012837 | Bacteria | 5317 |
| 6 | Ga0466699_146945 | 3300042597 | Bacteria | 6776 |
| 7 | Ga0466730_048395 | 3300042625 | Bacteria | 298700 |
| 8 | Ga0466703_135593 | 3300042636 | Bacteria | 14337 |
| 9 | Ga0466703_234815 | 3300042636 | Bacteria | 52704 |
| 10 | Ga0466704_246960 | 3300042643 | Bacteria | 12341 |
| 11 | Ga0466704_526888 | 3300042643 | Bacteria | 3037 |
| 12 | Ga0466724_02720 | 3300042649 | Bacteria | 247008 |
| 13 | JGI24698J34947_10008820 | 3300002449 | Unclassified | 5533 |
| 14 | Ga0072941_1000834 | 3300005201 | Bacteria | 15800 |
| 15 | Ga0072941_1000837 | 3300005201 | Unclassified | 6951 |
| 16 | Ga0562379_0513 | 3300056790 | Unclassified | 77111 |
| 17 | Ga0562377_0239 | 3300056842 | Bacteria | 130157 |
| 18 | Ga0562376_1461 | 3300056857 | Unclassified | 33158 |
| 19 | Ga0562374_0193 | 3300057007 | Unclassified | 131220 |
| 20 | Ga0562374_1213 | 3300057007 | Unclassified | 32214 |
| 21 | Ga0466696_090559 | 3300042596 | Bacteria | 28933 |
| 22 | Ga0466699_068378 | 3300042597 | Bacteria | 23608 |
| 23 | Ga0466729_205722 | 3300042621 | Bacteria | 3453 |
| 24 | Ga0466708_200914 | 3300042652 | Bacteria | 3543 |
| 25 | SCG598O02_11502 | 3300000460 | Bacteria | 56074 |
| 26 | Ga0072940_1132259 | 3300005200 | Bacteria | 21206 |
| 27 | Ga0072941_1000839 | 3300005201 | Unclassified | 10266 |
| 28 | Ga0104019_1000403 | 3300007150 | Bacteria | 7671 |
| 29 | Ga0466723_002933 | 3300042618 | Bacteria | 27474 |
| 30 | Ga0466723_239629 | 3300042618 | Bacteria | 3482 |
| 31 | Ga0466705_049732 | 3300042612 | Unclassified | 6654 |
| 32 | Ga0466705_254218 | 3300042612 | Bacteria | 15568 |
| 33 | Ga0466705_282345 | 3300042612 | Bacteria | 11843 |
| 34 | Ga0562374_0164 | 3300057007 | Unclassified | 152696 |
| 35 | Ga0466701_032874 | 3300042598 | Bacteria | 41464 |
| 36 | Ga0466701_068877 | 3300042598 | Bacteria | 86362 |
| 37 | Ga0466707_018711 | 3300042601 | Bacteria | 29522 |
| 38 | Ga0466707_081421 | 3300042601 | Bacteria | 7880 |
| 39 | Ga0466713_013162 | 3300042602 | Bacteria | 27722 |
| 40 | Ga0160453_100037 | 3300012814 | Bacteria | 166272 |
| 41 | Ga0160472_100607 | 3300012839 | Unclassified | 19798 |
| 42 | Ga0264413_106741 | 3300024493 | Bacteria | 5101 |
| 43 | Ga0466693_424045 | 3300042592 | Bacteria | 2153 |
| 44 | Ga0466701_006539 | 3300042598 | Bacteria | 166094 |
| 45 | Ga0160464_100171 | 3300012805 | Bacteria | 69359 |
| 46 | Ga0466703_116026 | 3300042636 | Bacteria | 4405 |
| 47 | Ga0466704_294219 | 3300042643 | Bacteria | 55450 |
| 48 | Ga0466726_019594 | 3300042619 | Bacteria | 10896 |
| 49 | Ga0466728_136946 | 3300042620 | Bacteria | 8947 |
| 50 | Ga0466705_082319 | 3300042612 | Bacteria | 39236 |
| 51 | Ga0562376_5137 | 3300056857 | Bacteria | 9237 |
| 52 | Ga0466719_322226 | 3300042606 | Bacteria | 5324 |
| 53 | Ga0264413_100354 | 3300024493 | Bacteria | 36172 |
| 54 | Ga0255572_1000007 | 3300026175 | Bacteria | 235375 |
| 55 | Ga0466692_177203 | 3300042591 | Bacteria | 2585 |
| 56 | Ga0466696_048471 | 3300042596 | Bacteria | 12607 |
| 57 | Ga0160466_103110 | 3300012809 | Unclassified | 2887 |
| 58 | Ga0466703_411528 | 3300042636 | Bacteria | 5702 |
| 59 | Ga0466724_22604 | 3300042649 | Bacteria | 3437 |
| 60 | Ga0466708_396804 | 3300042652 | Bacteria | 4776 |
| 61 | Ga0466712_093008 | 3300042614 | Unclassified | 12110 |
| 62 | Ga0466712_109181 | 3300042614 | Unclassified | 8855 |
| 63 | Ga0466711_102528 | 3300042615 | Bacteria | 24279 |
| 64 | Ga0466715_421496 | 3300042616 | Bacteria | 13769 |
| 65 | Ga0466726_122054 | 3300042619 | Bacteria | 5609 |
| 66 | Ga0466728_277988 | 3300042620 | Bacteria | 2962 |
| 67 | Ga0562377_0042 | 3300056842 | Bacteria | 605479 |
| 68 | Ga0562375_0500 | 3300056856 | Bacteria | 80617 |
| 69 | Ga0562374_0045 | 3300057007 | Unclassified | 593659 |
| 70 | Ga0562374_2154 | 3300057007 | Bacteria | 18761 |
| 71 | Ga0466707_288168 | 3300042601 | Bacteria | 17797 |
| 72 | Ga0466713_012949 | 3300042602 | Bacteria | 10359 |
| 73 | Ga0466699_028381 | 3300042597 | Bacteria | 4693 |
| 74 | Ga0466701_004279 | 3300042598 | Bacteria | 4061 |
| 75 | Ga0466730_009837 | 3300042625 | Bacteria | 325641 |
| 76 | Ga0466724_02699 | 3300042649 | Bacteria | 72032 |
| 77 | Ga0466724_06985 | 3300042649 | Bacteria | 79949 |
| 78 | SWWA_contig10526__length_3474___numreads_53 | 2100351016 | Unclassified | 3474 |
| 79 | Meta3P_1002895 | 3300002464 | Bacteria | 10278 |
| 80 | Ga0072941_1000836 | 3300005201 | Unclassified | 8716 |
| 81 | Ga0466711_497723 | 3300042615 | Bacteria | 12246 |
| 82 | Ga0466723_137817 | 3300042618 | Bacteria | 12808 |
| 83 | Ga0466705_197395 | 3300042612 | Bacteria | 16742 |
| 84 | Ga0562379_0166 | 3300056790 | Unclassified | 195826 |
| 85 | Ga0562377_0074 | 3300056842 | Bacteria | 389509 |
| 86 | Ga0562374_0212 | 3300057007 | Bacteria | 123353 |
| 87 | Ga0466707_030407 | 3300042601 | Bacteria | 4251 |
| 88 | Ga0466707_275623 | 3300042601 | Bacteria | 12682 |
| 89 | Ga0466719_230873 | 3300042606 | Unclassified | 5598 |
| 90 | Ga0466722_022870 | 3300042609 | Bacteria | 9131 |
| 91 | Ga0160432_100004 | 3300012818 | Bacteria | 604772 |
| 92 | Ga0466692_191449 | 3300042591 | Bacteria | 2738 |
| 93 | Ga0466699_322043 | 3300042597 | Bacteria | 20531 |
| 94 | Ga0123355_10022372 | 3300009826 | Bacteria | 10133 |
| 95 | Ga0160442_100019 | 3300012806 | Unclassified | 338988 |
| 96 | Ga0466730_039992 | 3300042625 | Bacteria | 1355215 |
| 97 | Ga0466703_218677 | 3300042636 | Bacteria | 6553 |
| 98 | Ga0466704_483366 | 3300042643 | Bacteria | 2210 |
| 99 | Ga0466724_43696 | 3300042649 | Bacteria | 561295 |
| 100 | Ga0466705_389991 | 3300042612 | Bacteria | 2888 |
| 101 | Ga0466715_160590 | 3300042616 | Bacteria | 34416 |
| 102 | Ga0466726_383822 | 3300042619 | Bacteria | 6498 |
| 103 | Ga0466728_025305 | 3300042620 | Bacteria | 11300 |
| 104 | Ga0466728_199156 | 3300042620 | Bacteria | 4079 |
| 105 | Ga0562379_3076 | 3300056790 | Unclassified | 11975 |
| 106 | Ga0562377_0422 | 3300056842 | Unclassified | 74000 |
| 107 | Ga0466707_307560 | 3300042601 | Bacteria | 8840 |
| 108 | Ga0466716_125208 | 3300042605 | Bacteria | 4436 |
| 109 | Ga0466720_034181 | 3300042607 | Bacteria | 7208 |
| 110 | Ga0466720_041454 | 3300042607 | Unclassified | 2573 |
| 111 | Ga0160459_100706 | 3300012831 | Bacteria | 11415 |
| 112 | Ga0466703_222557 | 3300042636 | Bacteria | 4302 |
| 113 | Ga0466724_57068 | 3300042649 | Unclassified | 23272 |
| 114 | SCG598P14_112480 | 3300000479 | Bacteria | 63944 |
| 115 | JGI24698J34947_10021638 | 3300002449 | Unclassified | 3455 |
| 116 | Ga0063521_1000536 | 3300003973 | Bacteria | 16785 |
| 117 | Ga0074308_1018377 | 3300005307 | Unclassified | 2950 |
| 118 | Ga0104045_1002681 | 3300007085 | Unclassified | 8153 |
| 119 | Ga0104041_1032544 | 3300007106 | Bacteria | 4319 |
| 120 | Ga0466723_045798 | 3300042618 | Bacteria | 21643 |
| 121 | Ga0466729_081394 | 3300042621 | Bacteria | 28662 |
| 122 | Ga0466729_154008 | 3300042621 | Bacteria | 3076 |
| 123 | Ga0466705_167570 | 3300042612 | Bacteria | 8922 |
| 124 | Ga0530661_000002 | 3300056564 | Bacteria | 530532 |
| 125 | Ga0562376_0142 | 3300056857 | Bacteria | 157622 |
| 126 | Ga0562376_0698 | 3300056857 | Unclassified | 55752 |
| 127 | Ga0562376_1508 | 3300056857 | Bacteria | 32235 |
| 128 | Ga0466707_032911 | 3300042601 | Bacteria | 2112 |
| 129 | Ga0466713_059288 | 3300042602 | Bacteria | 171779 |
| 130 | Ga0466714_004981 | 3300042603 | Bacteria | 11484 |
| 131 | Ga0466722_170661 | 3300042609 | Bacteria | 22453 |
| 132 | Ga0160467_100956 | 3300012829 | Bacteria | 16461 |
| 133 | Ga0466699_048800 | 3300042597 | Bacteria | 7156 |
| 134 | Ga0160454_100061 | 3300012798 | Bacteria | 156776 |
| 135 | Ga0466704_621043 | 3300042643 | Bacteria | 6215 |
| 136 | SCG598J21_11619 | 3300000475 | Unclassified | 30466 |
| 137 | JGI24698J34947_10001579 | 3300002449 | Bacteria | 12072 |
| 138 | JGI24700J35501_10930615 | 3300002508 | Bacteria | 16789 |
| 139 | Ga0063521_1000001 | 3300003973 | Bacteria | 444973 |
| 140 | Ga0466712_259166 | 3300042614 | Unclassified | 4790 |
| 141 | Ga0466711_226211 | 3300042615 | Bacteria | 2747 |
| 142 | Ga0466723_178974 | 3300042618 | Bacteria | 3655 |
| 143 | Ga0466728_044962 | 3300042620 | Bacteria | 9767 |
| 144 | Ga0466728_056335 | 3300042620 | Bacteria | 48636 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01979 | GO:0016787 | hydrolase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.