Protein Family IF03612

Metagenome Isolate
134 Members
72 Samples
100 Scaffolds
347.21 Avg Length

🧬 Representative Sequence

ID
3300012809|Ga0160466_100073|Ga0160466_10007322
Length
382 aa
Sequence
VTHTHHEPHDDDPDAGRARDGHALHGEYKVPGGKLVTVDLTVRAGVLDHVRVAGDFFLEPDEALVEIDAALTGLPADTTTSRLAEAVREHLAAAQDAGRLVGPVSMVGFDEHAVAVAVRRALGRSTTWADHTFEVIRPGPFAPALHAALDQVLTEELAAGRRGPTLRFWEWEEPAVIIGSFQSLRNEVDLEAAERYGITVVRRISGGGAMFMEAGNCITFSLVVPGSLVDGMTFEESYAFLNQWVLGALADVGVAATLSGLNDISSPGGKLAGSAQKRLVGGAVLHHVTMSYDIDAAKMLEVLRIGREKVSDKGTRSAAKRVDPVRSQTHLPRVDVIDAFEAHFRTHYPSVSGELRADELARAEQLRVHKFSDPAWTARVP*

📊 Sample Types

Isolate 25.4%
Metagenome 74.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 30.8%
Termitidae 20.0%
Kalotermitidae 15.4%
Cambaridae 7.7%
Culicidae 7.7%
Scarabaeidae 4.6%
Rhinotermitidae 3.1%
Hydrophilidae 3.1%
Ixodidae 1.5%
Termopsidae 1.5%
Armadillidiidae 1.5%
Reduviidae 1.5%
Hodotermitidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 130
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
2 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
3 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
4 2862075925 Corynebacterium lactis S064 Isolate Ixodidae
5 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
6 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
13 2909412500 Yimella sp. cx-573 Isolate Cambaridae
14 2931430189 Tessaracoccus palaemonis J1M15 Isolate
15 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
16 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
17 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
18 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
21 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
22 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
23 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
24 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
25 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
26 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
27 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
28 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
29 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
30 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
31 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
32 2505679068 Isoptericola variabilis 225 Isolate Unclassified
33 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
34 8062637095 Yimella sp. cx-51 Isolate Cambaridae
35 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
36 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
37 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
38 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
39 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
40 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
41 8062747827 Yimella sp. cx-51 Isolate Cambaridae
42 3006667155 Streptomyces sp. SID9727 Isolate
43 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
44 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
45 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
46 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
47 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
48 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
49 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
50 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
51 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
52 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
53 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
54 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
55 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
56 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
57 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
58 2504756063 Isoptericola variabilis J5 Isolate Unclassified
59 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
60 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
61 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
62 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
63 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
64 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
65 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
66 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
67 2912817845 Streptomyces griseus SID164 Isolate
68 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
69 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
70 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
71 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
72 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_056325 3300042612 Bacteria 1842
2 Ga0466733_102585 3300042659 Bacteria 133807
3 JGI24699J35502_11133971 3300002509 Bacteria 21992
4 Ga0123357_10000007 3300009784 Bacteria 257289
5 Ga0466723_248139 3300042618 Bacteria 3716
6 Ga0466703_138789 3300042636 Bacteria 30404
7 Ga0466704_209805 3300042643 Bacteria 27042
8 Ga0123356_10000068 3300010049 Bacteria 108740
9 Ga0123354_10080324 3300010882 Bacteria 4617
10 Ga0160466_100073 3300012809 Bacteria 108791
11 Ga0466707_302191 3300042601 Bacteria 41985
12 Ga0466713_047200 3300042602 Bacteria 14547
13 Ga0160452_100205 3300012834 Bacteria 63686
14 Ga0160436_1000063 3300012861 Bacteria 56546
15 Ga0466697_170046 3300042611 Bacteria 2535
16 Ga0466733_072257 3300042659 Bacteria 8315
17 Ga0123357_10000457 3300009784 Bacteria 39518
18 Ga0466715_172117 3300042616 Bacteria 21682
19 Ga0466704_360510 3300042643 Bacteria 7834
20 Ga0123356_10004461 3300010049 Bacteria 14469
21 Ga0466700_108826 3300042600 Bacteria 11898
22 Ga0466719_192771 3300042606 Bacteria 52306
23 Ga0160452_100211 3300012834 Bacteria 61762
24 Ga0466692_062034 3300042591 Bacteria 12154
25 Ga0466696_277875 3300042596 Bacteria 4888
26 JGI24699J35502_11051745 3300002509 Bacteria 1658
27 JGI24699J35502_11130938 3300002509 Bacteria 5376
28 Ga0466705_494940 3300042612 Bacteria 4601
29 Ga0466723_012640 3300042618 Bacteria 4375
30 Ga0466703_012543 3300042636 Bacteria 6216
31 Ga0466727_214504 3300042655 Bacteria 26007
32 Ga0466727_278244 3300042655 Bacteria 8808
33 Ga0123356_10000416 3300010049 Bacteria 48609
34 Ga0123356_10044930 3300010049 Bacteria 4111
35 Ga0160446_101319 3300012835 Unclassified 5520
36 Ga0466696_178891 3300042596 Bacteria 9127
37 Ga0466696_263774 3300042596 Bacteria 13022
38 Ga0466705_376852 3300042612 Bacteria 2668
39 Ga0123357_10003224 3300009784 Bacteria 18583
40 Ga0466723_003291 3300042618 Bacteria 2985
41 Ga0466727_269844 3300042655 Bacteria 2579
42 Ga0123357_10008027 3300009784 Bacteria 13132
43 Ga0123357_10035061 3300009784 Bacteria 6822
44 Ga0123357_10082044 3300009784 Bacteria 4236
45 Ga0466707_123567 3300042601 Bacteria 2012
46 Ga0160459_109232 3300012831 Bacteria 1200
47 Ga0123357_10002981 3300009784 Bacteria 19160
48 Ga0466728_128283 3300042620 Bacteria 1677
49 Ga0466708_410670 3300042652 Bacteria 1626
50 Ga0123356_10019724 3300010049 Bacteria 6390
51 Ga0123354_10019423 3300010882 Bacteria 10673
52 Ga0123354_10181713 3300010882 Bacteria 2398
53 Ga0160442_100234 3300012806 Bacteria 40858
54 Ga0466707_042725 3300042601 Bacteria 3927
55 Ga0466707_215665 3300042601 Bacteria 13524
56 Ga0466717_118770 3300042604 Bacteria 9535
57 Ga0160432_101423 3300012818 Bacteria 7742
58 Ga0160458_100841 3300012832 Unclassified 8623
59 Ga0466693_109461 3300042592 Bacteria 182600
60 Ga0466691_019078 3300042593 Bacteria 4608
61 Ga0466723_036694 3300042618 Bacteria 6437
62 Ga0466728_358286 3300042620 Bacteria 1444
63 Ga0466703_048402 3300042636 Bacteria 91221
64 Ga0466708_252439 3300042652 Bacteria 3344
65 Ga0123357_10095316 3300009784 Bacteria 3859
66 Ga0123357_10344843 3300009784 Bacteria 1434
67 Ga0123354_10045360 3300010882 Bacteria 6728
68 Ga0466707_316054 3300042601 Bacteria 2224
69 Ga0466713_143179 3300042602 Bacteria 4964
70 Ga0160447_101836 3300012849 Bacteria 7882
71 Ga0466657_158735 3300042582 Bacteria 2387
72 Ga0466696_040705 3300042596 Bacteria 12078
73 Ga0466696_448525 3300042596 Bacteria 8153
74 Ga0466705_107046 3300042612 Bacteria 8347
75 Ga0466703_342396 3300042636 Bacteria 7220
76 Ga0466704_046112 3300042643 Bacteria 12478
77 Ga0123357_10090326 3300009784 Bacteria 3995
78 Ga0123356_10014325 3300010049 Bacteria 7628
79 Ga0123354_10040603 3300010882 Bacteria 7199
80 Ga0466706_166351 3300042599 Bacteria 10416
81 Ga0466700_066366 3300042600 Bacteria 1311
82 Ga0466713_044790 3300042602 Bacteria 5559
83 Ga0466693_258072 3300042592 Bacteria 38272
84 JGI24705J35276_12235802 3300002504 Bacteria 6996
85 Ga0123357_10000060 3300009784 Bacteria 86303
86 Ga0466728_183102 3300042620 Bacteria 2788
87 Ga0466728_185246 3300042620 Bacteria 1635
88 Ga0466729_297056 3300042621 Bacteria 2625
89 Ga0466730_014721 3300042625 Bacteria 1514
90 Ga0123357_10008430 3300009784 Bacteria 12871
91 Ga0123357_10036318 3300009784 Bacteria 6705
92 Ga0123356_10014674 3300010049 Unclassified 7529
93 Ga0123354_10007124 3300010882 Unclassified 16747
94 Ga0123354_10024614 3300010882 Bacteria 9499
95 Ga0123354_10058658 3300010882 Bacteria 5716
96 Ga0466706_196894 3300042599 Bacteria 81884
97 Ga0466713_062667 3300042602 Bacteria 5441
98 Ga0466713_125509 3300042602 Bacteria 5634
99 Ga0466698_047956 3300042610 Bacteria 3757
100 Ga0160457_1000118 3300012858 Bacteria 101854

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820944107 2820944295 312
2 3300042612 Ga0466705_376852 Ga0466705_376852_1639_2652 316
3 3300042593 Ga0466691_019078 Ga0466691_019078_1240_2289 319
4 3300010882 Ga0123354_10181713 Ga0123354_101817132 321
5 3300042601 Ga0466707_123567 Ga0466707_123567_169_1218 322
6 3300042643 Ga0466704_360510 Ga0466704_360510_1651_2631 326
7 3300042636 Ga0466703_138789 Ga0466703_138789_7249_8298 327
8 3300010882 Ga0123354_10007124 Ga0123354_1000712411 329
9 3300042596 Ga0466696_277875 Ga0466696_277875_536_1585 329
10 3300042601 Ga0466707_042725 Ga0466707_042725_1805_2854 329
11 3300042602 Ga0466713_143179 Ga0466713_143179_1692_2741 329
12 3300042606 Ga0466719_192771 Ga0466719_192771_35983_37032 329
13 3300042612 Ga0466705_056325 Ga0466705_056325_449_1498 329
14 3300042616 Ga0466715_172117 Ga0466715_172117_14438_15487 329
15 3300042618 Ga0466723_003291 Ga0466723_003291_173_1222 329
16 3300042618 Ga0466723_036694 Ga0466723_036694_2814_3863 329
17 3300042618 Ga0466723_248139 Ga0466723_248139_692_1741 329
18 3300042620 Ga0466728_183102 Ga0466728_183102_668_1717 329
19 3300042636 Ga0466703_048402 Ga0466703_048402_35634_36683 329
20 3300042652 Ga0466708_252439 Ga0466708_252439_1177_2226 329
21 3300042652 Ga0466708_410670 Ga0466708_410670_165_1214 329
22 3300042602 Ga0466713_044790 Ga0466713_044790_40_1089 331
23 3300042602 Ga0466713_062667 Ga0466713_062667_1533_2582 331
24 3300042602 Ga0466713_125509 Ga0466713_125509_1114_2163 331
25 3300042612 Ga0466705_107046 Ga0466705_107046_6197_7246 331
26 3300042618 Ga0466723_012640 Ga0466723_012640_1953_3002 331
27 3300042620 Ga0466728_128283 Ga0466728_128283_52_1101 331
28 3300010882 Ga0123354_10040603 Ga0123354_100406034 333
29 3300010049 Ga0123356_10000416 Ga0123356_1000041623 335
30 3300042643 Ga0466704_209805 Ga0466704_209805_19982_21031 336
31 3300002509 JGI24699J35502_11051745 JGI24699J35502_110517452 337
32 3300042620 Ga0466728_358286 Ga0466728_358286_284_1297 337
33 3300042636 Ga0466703_342396 Ga0466703_342396_1318_2397 337
34 3300002509 JGI24699J35502_11130938 JGI24699J35502_111309383 338
35 3300009784 Ga0123357_10003224 Ga0123357_1000322410 338
36 3300010049 Ga0123356_10004461 Ga0123356_100044619 339
37 3300010049 Ga0123356_10044930 Ga0123356_100449302 339
38 3300042655 Ga0466727_214504 Ga0466727_214504_17392_18441 340
39 3300042655 Ga0466727_278244 Ga0466727_278244_4967_6025 341
40 3300042611 Ga0466697_170046 Ga0466697_170046_1031_2122 343
41 3300042610 Ga0466698_047956 Ga0466698_047956_2089_3141 344
42 3300012834 Ga0160452_100211 Ga0160452_10021136 345
43 3300042621 Ga0466729_297056 Ga0466729_297056_942_2018 346
44 3300042659 Ga0466733_102585 Ga0466733_102585_36784_37824 346
45 3300042600 Ga0466700_066366 Ga0466700_066366_175_1242 347
46 3300042582 Ga0466657_158735 Ga0466657_158735_866_1915 349
47 3300042599 Ga0466706_196894 Ga0466706_196894_11913_12962 349
48 3300042600 Ga0466700_108826 Ga0466700_108826_7669_8718 349
49 3300042601 Ga0466707_215665 Ga0466707_215665_11737_12786 349
50 3300042601 Ga0466707_302191 Ga0466707_302191_22506_23555 349
51 3300042601 Ga0466707_316054 Ga0466707_316054_557_1606 349
52 3300042602 Ga0466713_047200 Ga0466713_047200_13422_14471 349
53 3300042604 Ga0466717_118770 Ga0466717_118770_7295_8344 349
54 3300042612 Ga0466705_494940 Ga0466705_494940_374_1423 349
55 3300042620 Ga0466728_185246 Ga0466728_185246_156_1205 349
56 3300042659 Ga0466733_072257 Ga0466733_072257_6537_7586 349
57 iso_pr_bacteria 2545824723 2546570697 349
58 iso_pr_bacteria 2681812870 2682013643 349
59 iso_pr_bacteria 2820816657 2820816987 349
60 iso_pr_bacteria 2820816657 2820818387 349
61 iso_pr_bacteria 2820829137 2820829618 349
62 iso_pr_bacteria 2820901319 2820901745 349
63 iso_pr_bacteria 2820911766 2820913615 349
64 iso_pr_bacteria 2820914081 2820915215 349
65 iso_pr_bacteria 2837204985 2837206347 349
66 iso_pr_bacteria 2873558832 2873560013 349
67 iso_pr_bacteria 2909412500 2909415426 349
68 iso_pr_bacteria 2931430189 2931430634 349
69 3300009784 Ga0123357_10000007 Ga0123357_10000007194 350
70 3300009784 Ga0123357_10090326 Ga0123357_100903262 350
71 3300009784 Ga0123357_10344843 Ga0123357_103448431 350
72 3300010049 Ga0123356_10014674 Ga0123356_100146742 350
73 3300010049 Ga0123356_10019724 Ga0123356_100197245 350
74 3300010882 Ga0123354_10019423 Ga0123354_1001942313 350
75 3300012858 Ga0160457_1000118 Ga0160457_100011846 350
76 3300012861 Ga0160436_1000063 Ga0160436_100006317 350
77 3300042599 Ga0466706_166351 Ga0466706_166351_8553_9605 350
78 3300010882 Ga0123354_10024614 Ga0123354_100246146 351
79 3300010882 Ga0123354_10080324 Ga0123354_100803244 351
80 iso_pr_bacteria 2873586004 2873588051 351
81 iso_pr_bacteria 2915166107 2915167201 351
82 iso_pr_bacteria 2915168811 2915171546 351
83 3300009784 Ga0123357_10000060 Ga0123357_1000006025 352
84 3300009784 Ga0123357_10082044 Ga0123357_100820445 352
85 3300042596 Ga0466696_040705 Ga0466696_040705_9394_10452 352
86 3300042625 Ga0466730_014721 Ga0466730_014721_45_1103 352
87 3300042636 Ga0466703_012543 Ga0466703_012543_2681_3739 352
88 3300042596 Ga0466696_178891 Ga0466696_178891_4172_5233 353
89 3300042596 Ga0466696_263774 Ga0466696_263774_10185_11246 353
90 3300042591 Ga0466692_062034 Ga0466692_062034_7704_8768 354
91 iso_pr_bacteria 2515154104 2515589677 354
92 iso_pr_bacteria 2912817845 2912821003 354
93 iso_pr_bacteria 3006667155 3006670360 354
94 iso_pr_bacteria 8062637095 8062637245 354
95 iso_pr_bacteria 8062747827 8062750948 354
96 3300009784 Ga0123357_10036318 Ga0123357_100363182 355
97 3300042655 Ga0466727_269844 Ga0466727_269844_388_1524 355
98 iso_pr_bacteria 2820922474 2820923298 355
99 3300002504 JGI24705J35276_12235802 JGI24705J35276_122358022 356
100 3300002509 JGI24699J35502_11133971 JGI24699J35502_1113397111 356
101 3300010049 Ga0123356_10014325 Ga0123356_100143256 356
102 iso_pr_bacteria 2820814774 2820816318 356
103 iso_pr_bacteria 2821314491 2821315864 357
104 3300009784 Ga0123357_10002981 Ga0123357_100029818 358
105 3300009784 Ga0123357_10008027 Ga0123357_100080277 358
106 3300010882 Ga0123354_10045360 Ga0123354_100453604 358
107 iso_pr_bacteria 2504756063 2504978768 358
108 iso_pr_bacteria 2505679068 2505953297 358
109 iso_pr_bacteria 2820825283 2820826220 358
110 iso_pr_bacteria 2820849606 2820851526 358
111 iso_pr_bacteria 2820909719 2820910372 358
112 iso_pr_bacteria 2820926697 2820927793 358
113 iso_pr_bacteria 2848356102 2848357748 358
114 3300010049 Ga0123356_10000068 Ga0123356_1000006870 359
115 3300010882 Ga0123354_10058658 Ga0123354_100586585 359
116 3300012806 Ga0160442_100234 Ga0160442_1002344 359
117 3300012832 Ga0160458_100841 Ga0160458_1008416 359
118 3300012834 Ga0160452_100205 Ga0160452_10020552 359
119 3300012835 Ga0160446_101319 Ga0160446_1013195 359
120 3300012849 Ga0160447_101836 Ga0160447_1018366 359
121 3300042592 Ga0466693_109461 Ga0466693_109461_89386_90495 359
122 3300042592 Ga0466693_258072 Ga0466693_258072_14245_15390 359
123 3300009784 Ga0123357_10000457 Ga0123357_100004578 360
124 3300009784 Ga0123357_10035061 Ga0123357_100350615 360
125 3300009784 Ga0123357_10095316 Ga0123357_100953163 360
126 3300012818 Ga0160432_101423 Ga0160432_1014234 361
127 iso_pr_bacteria 2731957681 2732700025 361
128 3300009784 Ga0123357_10008430 Ga0123357_100084305 363
129 3300012831 Ga0160459_109232 Ga0160459_1092321 364
130 iso_pr_bacteria 2820897376 2820899651 365
131 3300042596 Ga0466696_448525 Ga0466696_448525_6606_7709 367
132 iso_pr_bacteria 2862075925 2862076470 367
133 3300042643 Ga0466704_046112 Ga0466704_046112_5954_7159 381
134 3300012809 Ga0160466_100073 Ga0160466_10007322 382

🧩 MSA Aligner

Download FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF21948 LplA-B_cat Lipoyl protein ligase A/B catalytic domain 143 344 0.95
PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family 185 295 0.81

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03099 GO:0036211 protein modification process BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.