Protein Family IF03542
Metagenome
Isolate
177
Members
55
Samples
170
Scaffolds
377.58
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10287291|Ga0123354_102872911
- Length
- 406 aa
- Sequence
- MKNPFLVSGYISKEYFCDRVEESKNLLKLVTNGNNVLLVSPRRMGKTGLIEHCFRNPNIKKDYYTFFVDIYATSNLQTFTYKLGKEIFNQLKPKGKKFLENFFAIISSLRPAFKLDENSGAPVFDIGIGEIRSPEFTLEEIFKYLNLSDKPCIIAIDEFQQIAKYPEKNIEATLRTHIQKTTNSAFIFSGSQRHILHEMFFSASKPFYQSAVLQSLDVICKSEYIKFASNLFKKGKKIVDNSFIEKAYYLFEGHTFYVQSVLNQLFSELDENEKCTNKIFEKAVINRIFSYNTLFSEILNLLPDRQKECLYAIAKEGKTTNITSGDFVKKHALHSSASVQTAVRQLIDKELLTKNLNIYSVYDRFFDFWLKSNFGAVELLNLDKFIYRTEAKITLSHTPPTTAKL*
Sample Types
Isolate
3.4%
Metagenome
96.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.5%
Kalotermitidae
23.6%
Unclassified
12.7%
Termopsidae
7.3%
Blattidae
3.6%
Passalidae
3.6%
Hodotermitidae
1.8%
Rhinotermitidae
1.8%
Taxonomy
Archaea
1
Bacteria
170
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 5 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 6 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 20 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 21 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 22 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 23 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 26 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 34 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 42 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 43 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 44 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 45 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 46 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 47 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 49 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 50 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 51 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 52 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 53 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 54 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 55 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_065070 | 3300042659 | Bacteria | 1530 |
| 2 | Ga0466691_040836 | 3300042593 | Bacteria | 24285 |
| 3 | Ga0466696_095898 | 3300042596 | Bacteria | 8814 |
| 4 | Ga0123353_10092186 | 3300010167 | Bacteria | 4880 |
| 5 | Ga0466714_029318 | 3300042603 | Bacteria | 2350 |
| 6 | Ga0466714_088607 | 3300042603 | Bacteria | 2805 |
| 7 | 2227507947 | 2225789004 | Bacteria | 71292 |
| 8 | 2227535714 | 2225789004 | Bacteria | 63282 |
| 9 | IMNBL1DRAFT_c0004649 | 3300000062 | Bacteria | 8149 |
| 10 | Ga0466731_126869 | 3300042622 | Bacteria | 9260 |
| 11 | Ga0466731_330205 | 3300042622 | Bacteria | 4410 |
| 12 | Ga0466697_198141 | 3300042611 | Bacteria | 1093 |
| 13 | Ga0466697_228243 | 3300042611 | Bacteria | 3789 |
| 14 | Ga0466690_067366 | 3300042590 | Bacteria | 2716 |
| 15 | Ga0466691_175433 | 3300042593 | Bacteria | 4900 |
| 16 | Ga0123353_10326915 | 3300010167 | Bacteria | 2324 |
| 17 | Ga0123353_10487413 | 3300010167 | Bacteria | 1801 |
| 18 | Ga0123354_10137306 | 3300010882 | Bacteria | 3049 |
| 19 | Ga0466701_069369 | 3300042598 | Bacteria | 58155 |
| 20 | Ga0466701_097399 | 3300042598 | Bacteria | 121087 |
| 21 | Ga0466713_043928 | 3300042602 | Bacteria | 2825 |
| 22 | Ga0466714_009868 | 3300042603 | Bacteria | 1423 |
| 23 | Ga0466714_067543 | 3300042603 | Bacteria | 3988 |
| 24 | Ga0466714_077709 | 3300042603 | Bacteria | 26910 |
| 25 | Ga0466721_010295 | 3300042608 | Bacteria | 2118 |
| 26 | Ga0466698_159015 | 3300042610 | Bacteria | 1196 |
| 27 | Ga0466698_468653 | 3300042610 | Bacteria | 4082 |
| 28 | 2227488538 | 2225789004 | Bacteria | 20664 |
| 29 | JGI24702J35022_10012176 | 3300002462 | Bacteria | 4787 |
| 30 | JGI24702J35022_10038491 | 3300002462 | Bacteria | 2553 |
| 31 | Ga0466709_165161 | 3300042648 | Bacteria | 19220 |
| 32 | Ga0466724_07002 | 3300042649 | Bacteria | 1573 |
| 33 | Ga0466727_184040 | 3300042655 | Bacteria | 7230 |
| 34 | Ga0466710_093479 | 3300042613 | Bacteria | 3843 |
| 35 | Ga0466697_071506 | 3300042611 | Bacteria | 1914 |
| 36 | Ga0466705_034044 | 3300042612 | Bacteria | 7941 |
| 37 | Ga0466732_384214 | 3300042656 | Bacteria | 4051 |
| 38 | Ga0466733_067078 | 3300042659 | Bacteria | 1805 |
| 39 | Ga0466733_079693 | 3300042659 | Bacteria | 2760 |
| 40 | Ga0466693_093133 | 3300042592 | Bacteria | 4147 |
| 41 | Ga0466693_186062 | 3300042592 | Bacteria | 2583 |
| 42 | Ga0466691_101231 | 3300042593 | Bacteria | 36706 |
| 43 | Ga0466694_313844 | 3300042594 | Bacteria | 2567 |
| 44 | Ga0123353_10392416 | 3300010167 | Bacteria | 2070 |
| 45 | Ga0123354_10027097 | 3300010882 | Bacteria | 9029 |
| 46 | Ga0466700_412142 | 3300042600 | Bacteria | 2389 |
| 47 | Ga0466707_380382 | 3300042601 | Bacteria | 3255 |
| 48 | Ga0466713_102712 | 3300042602 | Bacteria | 2486 |
| 49 | Ga0466714_044522 | 3300042603 | Bacteria | 3863 |
| 50 | Ga0466714_055475 | 3300042603 | Bacteria | 1877 |
| 51 | Ga0466716_475296 | 3300042605 | Bacteria | 9321 |
| 52 | Ga0466721_366049 | 3300042608 | Bacteria | 1726 |
| 53 | Ga0466697_029076 | 3300042611 | Unclassified | 1296 |
| 54 | JGI24702J35022_10079708 | 3300002462 | Bacteria | 1773 |
| 55 | Ga0466735_178770 | 3300042624 | Bacteria | 6435 |
| 56 | Ga0466703_410448 | 3300042636 | Bacteria | 5080 |
| 57 | Ga0466708_256148 | 3300042652 | Bacteria | 12361 |
| 58 | Ga0466711_380688 | 3300042615 | Bacteria | 2554 |
| 59 | Ga0466715_259752 | 3300042616 | Bacteria | 10916 |
| 60 | Ga0466728_327582 | 3300042620 | Bacteria | 2659 |
| 61 | Ga0466697_179409 | 3300042611 | Bacteria | 152612 |
| 62 | Ga0466697_249115 | 3300042611 | Bacteria | 2566 |
| 63 | Ga0466733_053141 | 3300042659 | Bacteria | 3010 |
| 64 | Ga0466695_305689 | 3300042595 | Bacteria | 1525 |
| 65 | Ga0123357_10011387 | 3300009784 | Bacteria | 11399 |
| 66 | Ga0123357_10032404 | 3300009784 | Bacteria | 7098 |
| 67 | Ga0123353_10031880 | 3300010167 | Bacteria | 8174 |
| 68 | Ga0123354_10025192 | 3300010882 | Bacteria | 9382 |
| 69 | Ga0466701_051553 | 3300042598 | Bacteria | 4279 |
| 70 | Ga0466706_168401 | 3300042599 | Bacteria | 37088 |
| 71 | Ga0466707_296698 | 3300042601 | Bacteria | 7410 |
| 72 | Ga0466713_037944 | 3300042602 | Bacteria | 60611 |
| 73 | Ga0466714_000481 | 3300042603 | Bacteria | 4827 |
| 74 | Ga0466714_042673 | 3300042603 | Bacteria | 2837 |
| 75 | Ga0466714_095243 | 3300042603 | Bacteria | 9628 |
| 76 | Ga0466714_105823 | 3300042603 | Bacteria | 2072 |
| 77 | 2227516606 | 2225789004 | Bacteria | 3428 |
| 78 | 2227564093 | 2225789004 | Bacteria | 2692 |
| 79 | IMNBL1DRAFT_c0000470 | 3300000062 | Bacteria | 33673 |
| 80 | JGI24705J35276_12237597 | 3300002504 | Bacteria | 12007 |
| 81 | Ga0068305_10175092 | 3300005083 | Bacteria | 2968 |
| 82 | Ga0466731_056869 | 3300042622 | Bacteria | 2214 |
| 83 | Ga0466727_182475 | 3300042655 | Bacteria | 5952 |
| 84 | Ga0466710_401048 | 3300042613 | Bacteria | 1740 |
| 85 | Ga0466726_066658 | 3300042619 | Bacteria | 3184 |
| 86 | Ga0466728_455315 | 3300042620 | Bacteria | 12268 |
| 87 | Ga0466705_370959 | 3300042612 | Bacteria | 1538 |
| 88 | Ga0466733_080596 | 3300042659 | Archaea | 2728 |
| 89 | Ga0123356_10255392 | 3300010049 | Bacteria | 1833 |
| 90 | Ga0123353_10496840 | 3300010167 | Bacteria | 1779 |
| 91 | Ga0123353_10547632 | 3300010167 | Bacteria | 1670 |
| 92 | Ga0123354_10229682 | 3300010882 | Bacteria | 1944 |
| 93 | Ga0123354_10289314 | 3300010882 | Bacteria | 1574 |
| 94 | Ga0466700_202345 | 3300042600 | Bacteria | 1829 |
| 95 | Ga0466707_005791 | 3300042601 | Bacteria | 3142 |
| 96 | Ga0466707_249660 | 3300042601 | Bacteria | 1226 |
| 97 | Ga0466714_001491 | 3300042603 | Bacteria | 1231 |
| 98 | Ga0466714_043311 | 3300042603 | Bacteria | 4363 |
| 99 | Ga0466714_054166 | 3300042603 | Bacteria | 10984 |
| 100 | Ga0466717_150381 | 3300042604 | Bacteria | 3571 |
| 101 | Ga0466720_156027 | 3300042607 | Bacteria | 3070 |
| 102 | Ga0466698_127960 | 3300042610 | Bacteria | 1910 |
| 103 | JGI24702J35022_10026880 | 3300002462 | Bacteria | 3096 |
| 104 | Ga0068302_10010226 | 3300005071 | Unclassified | 5799 |
| 105 | Ga0466734_013579 | 3300042623 | Bacteria | 1423 |
| 106 | Ga0466704_318418 | 3300042643 | Bacteria | 10089 |
| 107 | Ga0466711_296882 | 3300042615 | Bacteria | 1895 |
| 108 | Ga0466711_426184 | 3300042615 | Bacteria | 1319 |
| 109 | Ga0466715_367602 | 3300042616 | Bacteria | 6011 |
| 110 | Ga0466726_272855 | 3300042619 | Bacteria | 3623 |
| 111 | Ga0466726_328018 | 3300042619 | Bacteria | 5470 |
| 112 | Ga0466705_105693 | 3300042612 | Bacteria | 24317 |
| 113 | Ga0466733_008626 | 3300042659 | Bacteria | 66692 |
| 114 | Ga0466733_031197 | 3300042659 | Bacteria | 2770 |
| 115 | Ga0466733_091567 | 3300042659 | Bacteria | 1302 |
| 116 | Ga0466690_059220 | 3300042590 | Bacteria | 6143 |
| 117 | Ga0466691_024990 | 3300042593 | Bacteria | 118277 |
| 118 | Ga0123354_10008251 | 3300010882 | Bacteria | 15818 |
| 119 | Ga0123354_10287291 | 3300010882 | Unclassified | 1584 |
| 120 | Ga0466706_252340 | 3300042599 | Bacteria | 21739 |
| 121 | Ga0466713_114189 | 3300042602 | Bacteria | 34018 |
| 122 | Ga0466714_039580 | 3300042603 | Bacteria | 1369 |
| 123 | Ga0466714_165957 | 3300042603 | Bacteria | 2232 |
| 124 | 2227560719 | 2225789004 | Bacteria | 14591 |
| 125 | JGI24702J35022_10036427 | 3300002462 | Bacteria | 2629 |
| 126 | JGI24696J40584_12944762 | 3300002834 | Bacteria | 1824 |
| 127 | Ga0068305_10004417 | 3300005083 | Bacteria | 55018 |
| 128 | Ga0068305_10721600 | 3300005083 | Bacteria | 1946 |
| 129 | Ga0466731_011055 | 3300042622 | Bacteria | 1738 |
| 130 | Ga0466710_013187 | 3300042613 | Unclassified | 1355 |
| 131 | Ga0466711_306525 | 3300042615 | Bacteria | 2201 |
| 132 | Ga0466697_106599 | 3300042611 | Bacteria | 91903 |
| 133 | Ga0466657_263307 | 3300042582 | Bacteria | 3263 |
| 134 | Ga0466693_237173 | 3300042592 | Bacteria | 1509 |
| 135 | Ga0123354_10294246 | 3300010882 | Unclassified | 1549 |
| 136 | Ga0466701_077922 | 3300042598 | Bacteria | 7465 |
| 137 | Ga0466701_095154 | 3300042598 | Bacteria | 4559 |
| 138 | Ga0466706_275233 | 3300042599 | Bacteria | 4023 |
| 139 | Ga0466707_280552 | 3300042601 | Bacteria | 12628 |
| 140 | Ga0466713_113556 | 3300042602 | Bacteria | 1869 |
| 141 | Ga0466714_002562 | 3300042603 | Bacteria | 43787 |
| 142 | Ga0466714_106484 | 3300042603 | Bacteria | 3459 |
| 143 | Ga0466714_161383 | 3300042603 | Bacteria | 3286 |
| 144 | Ga0466717_046974 | 3300042604 | Bacteria | 1722 |
| 145 | IMNBL1DRAFT_c0008325 | 3300000062 | Bacteria | 5293 |
| 146 | IMNBL1DRAFT_c0015400 | 3300000062 | Bacteria | 3320 |
| 147 | IMNBL1DRAFT_c0018361 | 3300000062 | Bacteria | 2911 |
| 148 | IMNBL1DRAFT_c0031095 | 3300000062 | Bacteria | 1947 |
| 149 | JGI24702J35022_10026714 | 3300002462 | Bacteria | 3109 |
| 150 | JGI24705J35276_12192424 | 3300002504 | Bacteria | 1487 |
| 151 | JGI24705J35276_12194572 | 3300002504 | Bacteria | 1514 |
| 152 | JGI24705J35276_12225719 | 3300002504 | Bacteria | 2758 |
| 153 | Ga0466727_237611 | 3300042655 | Unclassified | 5116 |
| 154 | Ga0466710_121363 | 3300042613 | Bacteria | 20587 |
| 155 | Ga0466726_238722 | 3300042619 | Bacteria | 1986 |
| 156 | Ga0466733_083813 | 3300042659 | Bacteria | 3197 |
| 157 | Ga0466733_094871 | 3300042659 | Bacteria | 3458 |
| 158 | Ga0466696_210339 | 3300042596 | Bacteria | 2726 |
| 159 | Ga0466719_137926 | 3300042606 | Bacteria | 4046 |
| 160 | Ga0466719_152702 | 3300042606 | Bacteria | 3735 |
| 161 | Ga0466721_185891 | 3300042608 | Bacteria | 28527 |
| 162 | Ga0466722_214552 | 3300042609 | Bacteria | 5685 |
| 163 | 2227200831 | 2225789004 | Bacteria | 1439 |
| 164 | 2227524073 | 2225789004 | Bacteria | 3282 |
| 165 | JGI24702J35022_10084712 | 3300002462 | Bacteria | 1720 |
| 166 | Ga0068302_10257591 | 3300005071 | Bacteria | 1214 |
| 167 | Ga0466735_103628 | 3300042624 | Bacteria | 1592 |
| 168 | Ga0466727_027143 | 3300042655 | Bacteria | 7690 |
| 169 | Ga0466727_264807 | 3300042655 | Bacteria | 1315 |
| 170 | Ga0466726_239743 | 3300042619 | Bacteria | 4373 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01637 | ATPase_2 | ATPase domain predominantly from Archaea | 16 | 257 | 0.79 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01637 | GO:0005524 | ATP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.