Protein Family IF03515
Metagenome
Isolate
171
Members
73
Samples
137
Scaffolds
222.09
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10148444|Ga0123354_101484442
- Length
- 222 aa
- Sequence
- MEIIQLENVHKVYRTKEIETIALENVNLTVGKGEFLSVMGPSGCGKSTLLNIIGLLDTPNQGVVTINGTNTSTLRDTPAAEFRNKTAGFIFQSFHLINSLNVLDNVQLPLLYRSGSFNRSQRAKEVLEKVGLSHRMKHFPTQLSGGQCQRVAIARAIVGNPEIILADEPTGNLDSKMGMEIIELLFDLNREGVTIIMVTHDENVAKKTKRIVRFFDGRQVE*
Sample Types
Isolate
19.9%
Metagenome
80.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
32.9%
Termitidae
24.7%
Kalotermitidae
19.2%
Unclassified
6.8%
Rhinotermitidae
5.5%
Termopsidae
5.5%
Passalidae
4.1%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
162
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 3 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 4 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 5 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 6 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 10 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 11 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 12 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 13 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 21 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 22 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 23 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 24 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 34 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 38 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 39 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 40 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 46 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 47 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 48 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 49 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 50 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 51 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 52 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 53 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 54 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 55 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 56 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 57 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 58 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 59 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 60 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 61 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 62 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 63 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 64 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 65 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 66 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 67 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 68 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 69 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 70 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 71 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 72 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 73 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_045905 | 3300042599 | Bacteria | 2098 |
| 2 | Ga0466713_139646 | 3300042602 | Bacteria | 516516 |
| 3 | Ga0466719_218399 | 3300042606 | Bacteria | 1371 |
| 4 | Ga0466722_031675 | 3300042609 | Bacteria | 4839 |
| 5 | Ga0466704_088764 | 3300042643 | Bacteria | 47132 |
| 6 | Ga0466709_255031 | 3300042648 | Bacteria | 12701 |
| 7 | Ga0466727_237063 | 3300042655 | Bacteria | 1379 |
| 8 | Ga0466711_092050 | 3300042615 | Bacteria | 33984 |
| 9 | Ga0466711_376535 | 3300042615 | Bacteria | 2680 |
| 10 | Ga0466728_052165 | 3300042620 | Bacteria | 25989 |
| 11 | Ga0466696_069317 | 3300042596 | Bacteria | 14105 |
| 12 | Ga0466696_304714 | 3300042596 | Bacteria | 4826 |
| 13 | Ga0123357_10094686 | 3300009784 | Bacteria | 3876 |
| 14 | Ga0466716_274265 | 3300042605 | Bacteria | 11797 |
| 15 | Ga0466722_174102 | 3300042609 | Bacteria | 10210 |
| 16 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 17 | Ga0466703_303147 | 3300042636 | Bacteria | 2764 |
| 18 | Ga0466709_400885 | 3300042648 | Bacteria | 3787 |
| 19 | Ga0466725_426273 | 3300042654 | Bacteria | 2494 |
| 20 | Ga0466711_130521 | 3300042615 | Bacteria | 23973 |
| 21 | Ga0466729_011082 | 3300042621 | Bacteria | 13295 |
| 22 | Ga0466729_033027 | 3300042621 | Bacteria | 11980 |
| 23 | Ga0466657_323072 | 3300042582 | Bacteria | 1073 |
| 24 | 2227008147 | 2225789003 | Bacteria | 23542 |
| 25 | JGI24702J35022_10007072 | 3300002462 | Bacteria | 6449 |
| 26 | JGI24699J35502_11133920 | 3300002509 | Bacteria | 19407 |
| 27 | JGI24699J35502_11134201 | 3300002509 | Bacteria | 54341 |
| 28 | Ga0123357_10001792 | 3300009784 | Bacteria | 23272 |
| 29 | Ga0466705_180601 | 3300042612 | Bacteria | 15876 |
| 30 | Ga0466733_092492 | 3300042659 | Bacteria | 17976 |
| 31 | Ga0123354_10148444 | 3300010882 | Bacteria | 2855 |
| 32 | Ga0466701_081600 | 3300042598 | Bacteria | 6902 |
| 33 | Ga0466706_052927 | 3300042599 | Bacteria | 2034 |
| 34 | Ga0466706_207157 | 3300042599 | Bacteria | 1877 |
| 35 | Ga0466707_058300 | 3300042601 | Bacteria | 1351 |
| 36 | Ga0466713_038764 | 3300042602 | Bacteria | 16332 |
| 37 | Ga0466713_137234 | 3300042602 | Bacteria | 24707 |
| 38 | Ga0466698_325518 | 3300042610 | Bacteria | 2438 |
| 39 | Ga0466735_159902 | 3300042624 | Bacteria | 3900 |
| 40 | Ga0466735_196657 | 3300042624 | Bacteria | 2462 |
| 41 | Ga0466703_075843 | 3300042636 | Bacteria | 8094 |
| 42 | Ga0466704_091217 | 3300042643 | Bacteria | 4917 |
| 43 | Ga0466727_002343 | 3300042655 | Bacteria | 10308 |
| 44 | Ga0466710_255321 | 3300042613 | Bacteria | 1628 |
| 45 | Ga0466715_115457 | 3300042616 | Bacteria | 36939 |
| 46 | Ga0466723_016493 | 3300042618 | Bacteria | 15588 |
| 47 | Ga0466726_040474 | 3300042619 | Bacteria | 6781 |
| 48 | Ga0466726_195635 | 3300042619 | Bacteria | 6124 |
| 49 | Ga0466692_005818 | 3300042591 | Bacteria | 74984 |
| 50 | Ga0466692_149579 | 3300042591 | Bacteria | 83669 |
| 51 | Ga0466696_368253 | 3300042596 | Bacteria | 8484 |
| 52 | IMNBL1DRAFT_c0002489 | 3300000062 | Bacteria | 12781 |
| 53 | IMNBL1DRAFT_c0029342 | 3300000062 | Bacteria | 2037 |
| 54 | Ga0466705_119745 | 3300042612 | Bacteria | 31799 |
| 55 | Ga0466705_316947 | 3300042612 | Bacteria | 39498 |
| 56 | Ga0466733_101223 | 3300042659 | Bacteria | 57262 |
| 57 | Ga0466733_216697 | 3300042659 | Bacteria | 189231 |
| 58 | Ga0466706_097294 | 3300042599 | Bacteria | 8262 |
| 59 | Ga0466707_078559 | 3300042601 | Bacteria | 10096 |
| 60 | Ga0466722_014428 | 3300042609 | Bacteria | 7860 |
| 61 | Ga0466731_139217 | 3300042622 | Bacteria | 5709 |
| 62 | Ga0466731_227089 | 3300042622 | Bacteria | 1373 |
| 63 | Ga0466727_136124 | 3300042655 | Unclassified | 5040 |
| 64 | Ga0466715_422122 | 3300042616 | Bacteria | 4668 |
| 65 | Ga0466726_186909 | 3300042619 | Bacteria | 4069 |
| 66 | Ga0466696_019214 | 3300042596 | Unclassified | 1600 |
| 67 | Ga0466696_281419 | 3300042596 | Bacteria | 25670 |
| 68 | Ga0466697_095834 | 3300042611 | Bacteria | 1422 |
| 69 | Ga0123356_10865816 | 3300010049 | Bacteria | 1075 |
| 70 | Ga0466707_219787 | 3300042601 | Bacteria | 3842 |
| 71 | Ga0466729_232625 | 3300042621 | Bacteria | 9552 |
| 72 | Ga0466703_125567 | 3300042636 | Bacteria | 8716 |
| 73 | Ga0466703_225493 | 3300042636 | Bacteria | 10266 |
| 74 | Ga0466704_090031 | 3300042643 | Bacteria | 1918 |
| 75 | Ga0466704_570593 | 3300042643 | Bacteria | 1387 |
| 76 | Ga0466726_302114 | 3300042619 | Bacteria | 1165 |
| 77 | Ga0466728_175052 | 3300042620 | Bacteria | 2156 |
| 78 | Ga0466690_086675 | 3300042590 | Bacteria | 50714 |
| 79 | 2227303015 | 2225789004 | Bacteria | 6605 |
| 80 | 2227466301 | 2225789004 | Bacteria | 24591 |
| 81 | IMNBL1DRAFT_c0018301 | 3300000062 | Bacteria | 2917 |
| 82 | Ga0068302_10075093 | 3300005071 | Bacteria | 5270 |
| 83 | Ga0466733_155136 | 3300042659 | Bacteria | 14358 |
| 84 | Ga0123356_10844438 | 3300010049 | Bacteria | 1087 |
| 85 | Ga0123354_10004434 | 3300010882 | Bacteria | 19900 |
| 86 | Ga0466706_222667 | 3300042599 | Bacteria | 8630 |
| 87 | Ga0466700_124418 | 3300042600 | Bacteria | 8391 |
| 88 | Ga0466707_351627 | 3300042601 | Bacteria | 6157 |
| 89 | Ga0466713_102098 | 3300042602 | Bacteria | 100663 |
| 90 | Ga0466717_282481 | 3300042604 | Bacteria | 1088 |
| 91 | Ga0466719_388947 | 3300042606 | Bacteria | 7195 |
| 92 | Ga0466729_199094 | 3300042621 | Bacteria | 2234 |
| 93 | Ga0466704_377608 | 3300042643 | Unclassified | 9656 |
| 94 | Ga0466709_262467 | 3300042648 | Bacteria | 7076 |
| 95 | Ga0466727_042357 | 3300042655 | Bacteria | 8786 |
| 96 | Ga0466727_132978 | 3300042655 | Bacteria | 6759 |
| 97 | Ga0466727_196859 | 3300042655 | Bacteria | 2325 |
| 98 | Ga0466711_089286 | 3300042615 | Bacteria | 2945 |
| 99 | Ga0466711_233629 | 3300042615 | Bacteria | 2282 |
| 100 | Ga0466728_228057 | 3300042620 | Bacteria | 7878 |
| 101 | Ga0466691_042749 | 3300042593 | Bacteria | 8949 |
| 102 | Ga0466694_364137 | 3300042594 | Bacteria | 1113 |
| 103 | Ga0466696_394022 | 3300042596 | Bacteria | 212291 |
| 104 | IMNBL1DRAFT_c0003711 | 3300000062 | Bacteria | 9590 |
| 105 | Ga0068305_10074349 | 3300005083 | Unclassified | 17325 |
| 106 | Ga0466705_334520 | 3300042612 | Bacteria | 18573 |
| 107 | Ga0466705_346162 | 3300042612 | Bacteria | 13356 |
| 108 | Ga0466733_115414 | 3300042659 | Bacteria | 30521 |
| 109 | Ga0466733_118149 | 3300042659 | Bacteria | 6747 |
| 110 | Ga0466701_033084 | 3300042598 | Bacteria | 19683 |
| 111 | Ga0466706_106819 | 3300042599 | Bacteria | 16267 |
| 112 | Ga0466704_354080 | 3300042643 | Bacteria | 2357 |
| 113 | Ga0466704_443184 | 3300042643 | Bacteria | 15005 |
| 114 | Ga0466709_047096 | 3300042648 | Bacteria | 173163 |
| 115 | Ga0466708_275929 | 3300042652 | Bacteria | 19874 |
| 116 | Ga0466710_150335 | 3300042613 | Bacteria | 1703 |
| 117 | Ga0466711_309338 | 3300042615 | Unclassified | 2667 |
| 118 | Ga0466715_513291 | 3300042616 | Bacteria | 19275 |
| 119 | Ga0466726_062025 | 3300042619 | Bacteria | 12997 |
| 120 | Ga0466726_363206 | 3300042619 | Bacteria | 4815 |
| 121 | Ga0466691_042241 | 3300042593 | Bacteria | 7707 |
| 122 | IMNBL1DRAFT_c0005146 | 3300000062 | Unclassified | 7594 |
| 123 | JGI24702J35022_10014375 | 3300002462 | Bacteria | 4366 |
| 124 | JGI24696J40584_12847856 | 3300002834 | Bacteria | 972 |
| 125 | Ga0466733_038409 | 3300042659 | Bacteria | 2906 |
| 126 | Ga0123353_10246159 | 3300010167 | Unclassified | 2774 |
| 127 | Ga0466707_047718 | 3300042601 | Bacteria | 1599 |
| 128 | Ga0466716_226225 | 3300042605 | Bacteria | 19357 |
| 129 | Ga0466704_149441 | 3300042643 | Unclassified | 10388 |
| 130 | Ga0466711_017768 | 3300042615 | Unclassified | 6339 |
| 131 | Ga0466711_128742 | 3300042615 | Bacteria | 3548 |
| 132 | Ga0466711_180904 | 3300042615 | Bacteria | 8816 |
| 133 | Ga0466657_078148 | 3300042582 | Bacteria | 6762 |
| 134 | 2227275262 | 2225789004 | Bacteria | 6851 |
| 135 | JGI24699J35502_11134195 | 3300002509 | Bacteria | 51638 |
| 136 | Ga0068305_10000798 | 3300005083 | Bacteria | 44439 |
| 137 | Ga0068305_10008764 | 3300005083 | Bacteria | 5855 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00005 | ABC_tran | ABC transporter | 23 | 170 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.