Protein Family IF03465

Metagenome Isolate
166 Members
50 Samples
164 Scaffolds
394.68 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10007652|Ga0123354_100076528
Length
416 aa
Sequence
MMYSIIAASSRKGARRLDRDQIRVLWDSMKPQLNEMQRRQYAATLSQAYGYGGATVIHEVTGVSLNTITAGKKDLGRRSEIGAGRVRKVGGGPKWLEEKHPDIQKQVRGIVDDSTYGTPEKALSWTTESLRSIQNTLAVKYGVNASHVTVGAILEGLGYSKQANQKMPQAGIPHPDRDAQFEFINEKAKGYMAAGEPVISVDTKKKENIGNFKNPGREYRRSKDPRKVLDHDFPLKELGKIAPYGVYNLNHNIGFVNVGTSHDTAEFAAESISRWWGAVGKRTFPNAGRLLITCDCGGSNGNRRRLWKYQLSQLAKRIGIEIHVSHFPPGTSKWNKVEHRLFCYISKNWQGKPLIDVETAIELIGSTTTKAGLKVICQRDDNVYELAAAVSDEDFDSINMEEIAPFESWNYIIKP*

📊 Sample Types

Isolate 1.2%
Metagenome 98.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 57.1%
Kalotermitidae 28.6%
Unclassified 8.2%
Termopsidae 4.1%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 31
Bacteria 99
Eukaryota 0
Viruses 0
Unclassified 36

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 2772190990 Unclassified Bathyarchaeota Emb289P1bin127 Isolate Unclassified
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
22 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
29 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
30 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
31 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
32 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 2772190996 Unclassified Bathyarchaeota Lab288P4bin61 Isolate Unclassified
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
40 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
41 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
42 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
49 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
50 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0068305_10375467 3300005083 Bacteria 1367
2 Ga0466710_146687 3300042613 Bacteria 1141
3 Ga0466723_211958 3300042618 Unclassified 2896
4 Ga0466726_244395 3300042619 Bacteria 1587
5 Ga0466694_072840 3300042594 Archaea 8841
6 Ga0466696_180153 3300042596 Unclassified 5586
7 Ga0466700_429009 3300042600 Bacteria 2195
8 Ga0466700_487500 3300042600 Archaea 2252
9 Ga0466719_428069 3300042606 Unclassified 2570
10 Ga0123357_10384911 3300009784 Bacteria 1297
11 Ga0123356_10336633 3300010049 Archaea 1628
12 Ga0466725_183450 3300042654 Bacteria 1294
13 Ga0466705_082907 3300042612 Unclassified 1285
14 Ga0466732_084521 3300042656 Unclassified 1371
15 Ga0072941_1196015 3300005201 Archaea 1361
16 Ga0466726_047986 3300042619 Bacteria 7346
17 Ga0466691_121171 3300042593 Bacteria 2122
18 Ga0466691_201690 3300042593 Bacteria 3472
19 Ga0466694_029049 3300042594 Bacteria 1621
20 Ga0466699_146646 3300042597 Unclassified 2801
21 Ga0466714_137609 3300042603 Unclassified 2687
22 Ga0466716_131165 3300042605 Archaea 1533
23 Ga0466719_038668 3300042606 Bacteria 3120
24 Ga0466719_481628 3300042606 Bacteria 1528
25 Ga0466698_071612 3300042610 Unclassified 3521
26 Ga0123356_10352371 3300010049 Bacteria 1596
27 Ga0123356_10409058 3300010049 Bacteria 1496
28 Ga0123356_10559684 3300010049 Bacteria 1305
29 Ga0123353_10604267 3300010167 Archaea 1567
30 Ga0123353_10804090 3300010167 Archaea 1298
31 Ga0466731_281928 3300042622 Archaea 1595
32 Ga0466734_155469 3300042623 Archaea 1786
33 Ga0466702_185044 3300042635 Bacteria 1871
34 Ga0466702_297018 3300042635 Archaea 1793
35 Ga0466704_340795 3300042643 Bacteria 14479
36 Ga0466704_528626 3300042643 Unclassified 2291
37 Ga0466709_158729 3300042648 Bacteria 7224
38 Ga0466697_079603 3300042611 Unclassified 1300
39 JGI24695J34938_10025902 3300002450 Unclassified 2795
40 Ga0466705_490627 3300042612 Bacteria 1664
41 Ga0466710_315377 3300042613 Bacteria 1842
42 Ga0466711_029411 3300042615 Bacteria 2241
43 Ga0466715_060035 3300042616 Bacteria 4941
44 Ga0466715_341682 3300042616 Unclassified 1931
45 Ga0466728_230320 3300042620 Bacteria 1296
46 Ga0466728_366170 3300042620 Bacteria 4146
47 Ga0466728_484881 3300042620 Bacteria 2052
48 Ga0466693_288889 3300042592 Bacteria 1711
49 Ga0466691_196432 3300042593 Unclassified 1805
50 Ga0466694_073434 3300042594 Archaea 1323
51 Ga0466716_164389 3300042605 Bacteria 3566
52 Ga0466719_138388 3300042606 Bacteria 2337
53 Ga0466719_223785 3300042606 Unclassified 2000
54 Ga0466720_089646 3300042607 Bacteria 1845
55 Ga0466698_110176 3300042610 Archaea 1558
56 Ga0123353_10451539 3300010167 Unclassified 1892
57 Ga0123353_10521957 3300010167 Bacteria 1723
58 Ga0123353_10700313 3300010167 Bacteria 1422
59 Ga0123353_10703783 3300010167 Bacteria 1417
60 Ga0466734_033343 3300042623 Bacteria 1387
61 Ga0466734_156128 3300042623 Archaea 1568
62 Ga0466702_463067 3300042635 Bacteria 1520
63 Ga0466704_111387 3300042643 Bacteria 2789
64 Ga0466725_087170 3300042654 Unclassified 1893
65 Ga0466725_158599 3300042654 Archaea 1655
66 JGI24695J34938_10055079 3300002450 Archaea 1721
67 Ga0072940_1302689 3300005200 Archaea 2148
68 Ga0072941_1094968 3300005201 Archaea 1289
69 Ga0466723_239343 3300042618 Unclassified 3747
70 Ga0466690_113628 3300042590 Bacteria 1732
71 Ga0466696_044828 3300042596 Unclassified 2061
72 Ga0466721_011921 3300042608 Bacteria 2286
73 Ga0466698_150648 3300042610 Archaea 1415
74 Ga0466698_254506 3300042610 Bacteria 1793
75 Ga0123356_10392071 3300010049 Unclassified 1524
76 Ga0123354_10007800 3300010882 Bacteria 16203
77 Ga0466731_181930 3300042622 Archaea 2113
78 Ga0466731_272393 3300042622 Bacteria 1489
79 Ga0466734_045657 3300042623 Archaea 2342
80 Ga0466702_434420 3300042635 Archaea 1515
81 Ga0466704_548909 3300042643 Bacteria 1723
82 Ga0466727_260428 3300042655 Bacteria 2556
83 Ga0466697_247811 3300042611 Unclassified 6747
84 JGI24695J34938_10069170 3300002450 Unclassified 1481
85 JGI24695J34938_10069698 3300002450 Bacteria 1473
86 Ga0466711_045351 3300042615 Bacteria 2015
87 Ga0466711_367982 3300042615 Archaea 1516
88 Ga0466715_574053 3300042616 Bacteria 1667
89 Ga0466715_602207 3300042616 Unclassified 1778
90 Ga0466723_145964 3300042618 Bacteria 2383
91 Ga0415639_194812 3300038395 Bacteria 1335
92 Ga0466693_347329 3300042592 Bacteria 1463
93 Ga0466706_091002 3300042599 Bacteria 1706
94 Ga0466707_206048 3300042601 Bacteria 1609
95 Ga0466707_416484 3300042601 Bacteria 1714
96 Ga0466716_152181 3300042605 Bacteria 2601
97 Ga0466721_121640 3300042608 Archaea 1443
98 Ga0466698_148701 3300042610 Bacteria 1589
99 Ga0123357_10258078 3300009784 Unclassified 1849
100 Ga0123357_10339679 3300009784 Bacteria 1454
101 Ga0123355_10041864 3300009826 Archaea 7457
102 Ga0123356_10563134 3300010049 Bacteria 1302
103 Ga0123354_10276593 3300010882 Unclassified 1640
104 Ga0466702_129891 3300042635 Unclassified 1789
105 Ga0466704_012476 3300042643 Unclassified 2530
106 Ga0466725_245948 3300042654 Bacteria 2242
107 Ga0466705_110228 3300042612 Bacteria 2332
108 Ga0466733_032049 3300042659 Bacteria 2681
109 Ga0466733_174187 3300042659 Bacteria 1388
110 JGI24695J34938_10081199 3300002450 Bacteria 1339
111 JGI24702J35022_10133655 3300002462 Archaea 1379
112 Ga0466715_222840 3300042616 Unclassified 2111
113 Ga0466723_145344 3300042618 Bacteria 5271
114 Ga0466693_089702 3300042592 Bacteria 2134
115 Ga0466691_076644 3300042593 Bacteria 13079
116 Ga0466694_311313 3300042594 Bacteria 1728
117 Ga0466719_087040 3300042606 Bacteria 1394
118 Ga0466719_556829 3300042606 Bacteria 4146
119 Ga0466698_098946 3300042610 Bacteria 1580
120 Ga0466731_111616 3300042622 Bacteria 1369
121 Ga0466702_353759 3300042635 Unclassified 2049
122 Ga0466703_404393 3300042636 Bacteria 15649
123 Ga0466704_352913 3300042643 Bacteria 1426
124 Ga0466708_287189 3300042652 Bacteria 1300
125 Ga0466725_049851 3300042654 Bacteria 2213
126 Ga0466697_277242 3300042611 Bacteria 1971
127 Ga0466733_033978 3300042659 Unclassified 1517
128 JGI24695J34938_10084341 3300002450 Bacteria 1309
129 JGI24705J35276_12184497 3300002504 Bacteria 1401
130 Ga0466710_066604 3300042613 Unclassified 2057
131 Ga0466715_220541 3300042616 Unclassified 1988
132 Ga0466690_043791 3300042590 Bacteria 2641
133 Ga0466693_083180 3300042592 Bacteria 1411
134 Ga0466694_340774 3300042594 Bacteria 1564
135 Ga0466701_079108 3300042598 Archaea 1656
136 Ga0466714_133147 3300042603 Bacteria 1722
137 Ga0123355_10414948 3300009826 Bacteria 1725
138 Ga0123355_10427827 3300009826 Unclassified 1686
139 Ga0123356_10075850 3300010049 Bacteria 3168
140 Ga0123356_10424566 3300010049 Archaea 1472
141 Ga0123354_10007652 3300010882 Bacteria 16311
142 Ga0466731_281218 3300042622 Archaea 1332
143 Ga0466734_042652 3300042623 Unclassified 1783
144 Ga0466703_156830 3300042636 Bacteria 2947
145 Ga0466709_044572 3300042648 Bacteria 4607
146 Ga0466727_246631 3300042655 Bacteria 1590
147 Ga0466697_247460 3300042611 Bacteria 2078
148 Ga0466705_045018 3300042612 Archaea 2201
149 Ga0466705_137878 3300042612 Bacteria 6054
150 JGI24702J35022_10066335 3300002462 Bacteria 1937
151 Ga0466715_504713 3300042616 Bacteria 2477
152 Ga0466723_020111 3300042618 Bacteria 17488
153 Ga0466723_262333 3300042618 Unclassified 1620
154 Ga0466690_434232 3300042590 Bacteria 6171
155 Ga0466693_170227 3300042592 Bacteria 1628
156 Ga0466691_152577 3300042593 Bacteria 1318
157 Ga0466694_191044 3300042594 Bacteria 2358
158 Ga0466699_369883 3300042597 Unclassified 1179
159 Ga0466717_203608 3300042604 Bacteria 1481
160 Ga0123357_10336818 3300009784 Bacteria 1465
161 Ga0466731_048962 3300042622 Bacteria 2308
162 Ga0466731_078161 3300042622 Bacteria 1445
163 Ga0466703_148939 3300042636 Bacteria 2842
164 Ga0466709_074313 3300042648 Unclassified 4622

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10700313 Ga0123353_107003131 335
2 3300042606 Ga0466719_038668 Ga0466719_038668_1375_2394 339
3 3300042613 Ga0466710_146687 Ga0466710_146687_104_1123 339
4 3300042615 Ga0466711_029411 Ga0466711_029411_760_1797 345
5 3300042615 Ga0466711_045351 Ga0466711_045351_495_1544 349
6 3300042597 Ga0466699_369883 Ga0466699_369883_43_1101 352
7 3300042659 Ga0466733_033978 Ga0466733_033978_202_1269 355
8 3300042643 Ga0466704_340795 Ga0466704_340795_1238_2323 361
9 3300042619 Ga0466726_047986 Ga0466726_047986_146_1234 362
10 3300042594 Ga0466694_073434 Ga0466694_073434_74_1297 374
11 3300042611 Ga0466697_247460 Ga0466697_247460_370_1500 376
12 3300010049 Ga0123356_10559684 Ga0123356_105596841 377
13 3300042594 Ga0466694_072840 Ga0466694_072840_3269_4471 377
14 3300042592 Ga0466693_089702 Ga0466693_089702_843_1988 381
15 3300042606 Ga0466719_087040 Ga0466719_087040_122_1267 381
16 3300042655 Ga0466727_246631 Ga0466727_246631_191_1381 383
17 3300042622 Ga0466731_181930 Ga0466731_181930_453_1673 384
18 3300042607 Ga0466720_089646 Ga0466720_089646_99_1262 387
19 3300002504 JGI24705J35276_12184497 JGI24705J35276_121844971 388
20 3300042590 Ga0466690_113628 Ga0466690_113628_254_1420 388
21 3300042596 Ga0466696_180153 Ga0466696_180153_579_1745 388
22 3300042598 Ga0466701_079108 Ga0466701_079108_206_1372 388
23 3300042610 Ga0466698_110176 Ga0466698_110176_276_1442 388
24 3300042616 Ga0466715_602207 Ga0466715_602207_172_1338 388
25 3300042618 Ga0466723_145964 Ga0466723_145964_445_1611 388
26 3300042618 Ga0466723_262333 Ga0466723_262333_147_1313 388
27 3300042623 Ga0466734_156128 Ga0466734_156128_236_1402 388
28 3300042635 Ga0466702_463067 Ga0466702_463067_224_1390 388
29 3300042648 Ga0466709_074313 Ga0466709_074313_3020_4186 388
30 3300042652 Ga0466708_287189 Ga0466708_287189_105_1271 388
31 3300002450 JGI24695J34938_10025902 JGI24695J34938_100259021 389
32 3300010049 Ga0123356_10392071 Ga0123356_103920712 389
33 3300010167 Ga0123353_10451539 Ga0123353_104515392 389
34 3300042600 Ga0466700_429009 Ga0466700_429009_885_2054 389
35 3300042611 Ga0466697_079603 Ga0466697_079603_102_1271 389
36 3300042612 Ga0466705_045018 Ga0466705_045018_263_1432 389
37 3300042612 Ga0466705_082907 Ga0466705_082907_31_1200 389
38 3300042613 Ga0466710_066604 Ga0466710_066604_672_1841 389
39 3300042622 Ga0466731_281928 Ga0466731_281928_145_1314 389
40 3300042643 Ga0466704_528626 Ga0466704_528626_411_1580 389
41 3300042636 Ga0466703_404393 Ga0466703_404393_13729_14931 390
42 3300042606 Ga0466719_556829 Ga0466719_556829_1601_2776 391
43 3300042622 Ga0466731_281218 Ga0466731_281218_20_1195 391
44 3300042643 Ga0466704_352913 Ga0466704_352913_67_1242 391
45 3300010167 Ga0123353_10604267 Ga0123353_106042672 392
46 3300042618 Ga0466723_239343 Ga0466723_239343_983_2161 392
47 3300042620 Ga0466728_366170 Ga0466728_366170_223_1401 392
48 3300005200 Ga0072940_1302689 Ga0072940_13026891 393
49 3300042648 Ga0466709_044572 Ga0466709_044572_1530_2711 393
50 3300042636 Ga0466703_156830 Ga0466703_156830_1165_2349 394
51 3300002450 JGI24695J34938_10069698 JGI24695J34938_100696982 395
52 3300009826 Ga0123355_10414948 Ga0123355_104149482 395
53 3300042590 Ga0466690_043791 Ga0466690_043791_266_1453 395
54 3300042592 Ga0466693_347329 Ga0466693_347329_160_1347 395
55 3300042593 Ga0466691_201690 Ga0466691_201690_885_2072 395
56 3300042601 Ga0466707_416484 Ga0466707_416484_231_1418 395
57 3300042605 Ga0466716_152181 Ga0466716_152181_636_1823 395
58 3300042605 Ga0466716_164389 Ga0466716_164389_1727_2914 395
59 3300042606 Ga0466719_481628 Ga0466719_481628_196_1383 395
60 3300042616 Ga0466715_504713 Ga0466715_504713_189_1376 395
61 3300042616 Ga0466715_574053 Ga0466715_574053_182_1369 395
62 3300042618 Ga0466723_211958 Ga0466723_211958_147_1334 395
63 3300042619 Ga0466726_244395 Ga0466726_244395_170_1357 395
64 3300042623 Ga0466734_033343 Ga0466734_033343_30_1217 395
65 3300042648 Ga0466709_158729 Ga0466709_158729_1099_2286 395
66 3300042610 Ga0466698_071612 Ga0466698_071612_1479_2669 396
67 3300042610 Ga0466698_150648 Ga0466698_150648_28_1218 396
68 3300042623 Ga0466734_045657 Ga0466734_045657_503_1693 396
69 3300042654 Ga0466725_158599 Ga0466725_158599_212_1402 396
70 3300010167 Ga0123353_10804090 Ga0123353_108040901 397
71 3300042643 Ga0466704_111387 Ga0466704_111387_267_1460 397
72 3300042615 Ga0466711_367982 Ga0466711_367982_145_1341 398
73 3300042622 Ga0466731_272393 Ga0466731_272393_184_1380 398
74 3300042636 Ga0466703_148939 Ga0466703_148939_268_1464 398
75 3300042594 Ga0466694_191044 Ga0466694_191044_608_1807 399
76 3300042594 Ga0466694_340774 Ga0466694_340774_218_1417 399
77 3300042610 Ga0466698_098946 Ga0466698_098946_204_1403 399
78 3300042620 Ga0466728_484881 Ga0466728_484881_532_1731 399
79 3300042622 Ga0466731_048962 Ga0466731_048962_198_1397 399
80 3300042635 Ga0466702_297018 Ga0466702_297018_157_1356 399
81 3300042654 Ga0466725_087170 Ga0466725_087170_196_1395 399
82 3300042656 Ga0466732_084521 Ga0466732_084521_154_1353 399
83 3300009784 Ga0123357_10339679 Ga0123357_103396791 400
84 3300010049 Ga0123356_10352371 Ga0123356_103523712 400
85 3300010049 Ga0123356_10563134 Ga0123356_105631341 400
86 3300010167 Ga0123353_10703783 Ga0123353_107037831 400
87 3300038395 Ga0415639_194812 Ga0415639_194812_24_1226 400
88 3300042590 Ga0466690_434232 Ga0466690_434232_2970_4172 400
89 3300042592 Ga0466693_083180 Ga0466693_083180_28_1230 400
90 3300042592 Ga0466693_170227 Ga0466693_170227_153_1355 400
91 3300042592 Ga0466693_288889 Ga0466693_288889_173_1375 400
92 3300042593 Ga0466691_076644 Ga0466691_076644_3110_4312 400
93 3300042593 Ga0466691_121171 Ga0466691_121171_540_1742 400
94 3300042593 Ga0466691_152577 Ga0466691_152577_86_1288 400
95 3300042593 Ga0466691_196432 Ga0466691_196432_270_1472 400
96 3300042594 Ga0466694_029049 Ga0466694_029049_93_1295 400
97 3300042594 Ga0466694_311313 Ga0466694_311313_125_1327 400
98 3300042597 Ga0466699_146646 Ga0466699_146646_1420_2622 400
99 3300042599 Ga0466706_091002 Ga0466706_091002_454_1656 400
100 3300042600 Ga0466700_487500 Ga0466700_487500_384_1586 400
101 3300042601 Ga0466707_206048 Ga0466707_206048_311_1513 400
102 3300042604 Ga0466717_203608 Ga0466717_203608_168_1370 400
103 3300042605 Ga0466716_131165 Ga0466716_131165_133_1335 400
104 3300042606 Ga0466719_138388 Ga0466719_138388_498_1700 400
105 3300042610 Ga0466698_148701 Ga0466698_148701_259_1461 400
106 3300042610 Ga0466698_254506 Ga0466698_254506_147_1349 400
107 3300042611 Ga0466697_277242 Ga0466697_277242_110_1312 400
108 3300042612 Ga0466705_110228 Ga0466705_110228_536_1738 400
109 3300042613 Ga0466710_315377 Ga0466710_315377_220_1422 400
110 3300042616 Ga0466715_060035 Ga0466715_060035_2080_3282 400
111 3300042620 Ga0466728_230320 Ga0466728_230320_20_1222 400
112 3300042622 Ga0466731_078161 Ga0466731_078161_97_1299 400
113 3300042622 Ga0466731_111616 Ga0466731_111616_137_1339 400
114 3300042623 Ga0466734_042652 Ga0466734_042652_342_1544 400
115 3300042635 Ga0466702_185044 Ga0466702_185044_335_1537 400
116 3300042635 Ga0466702_353759 Ga0466702_353759_243_1445 400
117 3300042635 Ga0466702_434420 Ga0466702_434420_138_1340 400
118 3300042654 Ga0466725_049851 Ga0466725_049851_384_1586 400
119 3300042654 Ga0466725_183450 Ga0466725_183450_39_1241 400
120 3300042655 Ga0466727_260428 Ga0466727_260428_1094_2296 400
121 3300042659 Ga0466733_032049 Ga0466733_032049_1355_2557 400
122 3300042659 Ga0466733_174187 Ga0466733_174187_176_1378 400
123 3300002450 JGI24695J34938_10069170 JGI24695J34938_100691701 401
124 3300002450 JGI24695J34938_10081199 JGI24695J34938_100811991 401
125 3300002450 JGI24695J34938_10084341 JGI24695J34938_100843411 401
126 3300002462 JGI24702J35022_10066335 JGI24702J35022_100663352 401
127 3300002462 JGI24702J35022_10133655 JGI24702J35022_101336551 401
128 3300005083 Ga0068305_10375467 Ga0068305_103754671 401
129 3300005201 Ga0072941_1094968 Ga0072941_10949681 401
130 3300005201 Ga0072941_1196015 Ga0072941_11960151 401
131 3300009784 Ga0123357_10336818 Ga0123357_103368181 401
132 3300009784 Ga0123357_10384911 Ga0123357_103849111 401
133 3300010049 Ga0123356_10075850 Ga0123356_100758503 401
134 3300010049 Ga0123356_10336633 Ga0123356_103366332 401
135 3300010049 Ga0123356_10409058 Ga0123356_104090582 401
136 3300010882 Ga0123354_10276593 Ga0123354_102765931 401
137 3300042608 Ga0466721_011921 Ga0466721_011921_67_1272 401
138 3300042612 Ga0466705_490627 Ga0466705_490627_347_1552 401
139 3300042616 Ga0466715_222840 Ga0466715_222840_888_2093 401
140 3300042616 Ga0466715_341682 Ga0466715_341682_406_1611 401
141 3300042618 Ga0466723_145344 Ga0466723_145344_679_1884 401
142 3300042623 Ga0466734_155469 Ga0466734_155469_172_1377 401
143 3300042635 Ga0466702_129891 Ga0466702_129891_343_1548 401
144 3300042654 Ga0466725_245948 Ga0466725_245948_335_1540 401
145 3300042596 Ga0466696_044828 Ga0466696_044828_660_1871 403
146 3300042603 Ga0466714_133147 Ga0466714_133147_409_1620 403
147 3300042603 Ga0466714_137609 Ga0466714_137609_21_1232 403
148 3300042606 Ga0466719_223785 Ga0466719_223785_534_1745 403
149 3300010167 Ga0123353_10521957 Ga0123353_105219572 405
150 iso_pu_archaea 2772190990 2773781001 405
151 3300009826 Ga0123355_10041864 Ga0123355_100418643 406
152 3300009826 Ga0123355_10427827 Ga0123355_104278272 407
153 3300042612 Ga0466705_137878 Ga0466705_137878_3717_4940 407
154 iso_pu_archaea 2772190996 2773792437 407
155 3300002450 JGI24695J34938_10055079 JGI24695J34938_100550791 408
156 3300009784 Ga0123357_10258078 Ga0123357_102580782 408
157 3300010882 Ga0123354_10007800 Ga0123354_1000780012 408
158 3300042608 Ga0466721_121640 Ga0466721_121640_145_1371 408
159 3300042643 Ga0466704_548909 Ga0466704_548909_83_1309 408
160 3300042611 Ga0466697_247811 Ga0466697_247811_4697_5926 409
161 3300010049 Ga0123356_10424566 Ga0123356_104245661 411
162 3300042606 Ga0466719_428069 Ga0466719_428069_714_1952 412
163 3300042616 Ga0466715_220541 Ga0466715_220541_389_1636 415
164 3300042643 Ga0466704_012476 Ga0466704_012476_924_2171 415
165 3300010882 Ga0123354_10007652 Ga0123354_100076528 416
166 3300042618 Ga0466723_020111 Ga0466723_020111_5756_7009 417

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07592 DDE_Tnp_ISAZ013 Rhodopirellula transposase DDE domain 108 415 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.58 0.64 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.