Protein Family IF03420
Metagenome
Isolate
138
Members
40
Samples
131
Scaffolds
150.36
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_12436822|Ga0123353_124368221
- Length
- 149 aa
- Sequence
- MSSQQNNLRLPEQNNVILVGRLTRDPEIRRTGTGKAVCSFDIAISSRIKDAATGQWKDSDPTYVPIVAWGDQADRCGERLKKGVPVVVDGRINMNEFTDKSGQNRKVLRVIANRVQVLQKDDNAGGGDNFPARENAPADAVAEDDVPF*
Sample Types
Isolate
5.1%
Metagenome
94.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
32.5%
Unclassified
25.0%
Termitidae
25.0%
Termopsidae
10.0%
Rhinotermitidae
2.5%
Hodotermitidae
2.5%
Passalidae
2.5%
Taxonomy
Archaea
0
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
27
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 16 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 17 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 18 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 21 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 22 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 28 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 29 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 30 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 36 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 39 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_136211 | 3300042590 | Bacteria | 4938 |
| 2 | Ga0466690_181313 | 3300042590 | Bacteria | 37423 |
| 3 | Ga0466691_101978 | 3300042593 | Unclassified | 2571 |
| 4 | Ga0466696_038073 | 3300042596 | Unclassified | 4171 |
| 5 | Ga0123355_10085403 | 3300009826 | Unclassified | 5022 |
| 6 | Ga0123353_10648221 | 3300010167 | Bacteria | 1496 |
| 7 | Ga0123354_10001202 | 3300010882 | Unclassified | 30549 |
| 8 | Ga0466735_071930 | 3300042624 | Bacteria | 36207 |
| 9 | Ga0466735_157086 | 3300042624 | Bacteria | 5317 |
| 10 | Ga0466717_193066 | 3300042604 | Unclassified | 2692 |
| 11 | Ga0068305_10000079 | 3300005083 | Bacteria | 163717 |
| 12 | Ga0466715_056323 | 3300042616 | Bacteria | 22190 |
| 13 | Ga0466723_302128 | 3300042618 | Bacteria | 32810 |
| 14 | Ga0466726_102192 | 3300042619 | Unclassified | 2149 |
| 15 | Ga0466729_067423 | 3300042621 | Bacteria | 3053 |
| 16 | Ga0466705_120086 | 3300042612 | Unclassified | 3348 |
| 17 | Ga0466690_339504 | 3300042590 | Bacteria | 5530 |
| 18 | Ga0466691_059165 | 3300042593 | Bacteria | 30842 |
| 19 | Ga0466696_107881 | 3300042596 | Bacteria | 4052 |
| 20 | Ga0123357_10005260 | 3300009784 | Bacteria | 15436 |
| 21 | Ga0466735_024241 | 3300042624 | Bacteria | 3708 |
| 22 | Ga0466735_131195 | 3300042624 | Bacteria | 2252 |
| 23 | Ga0466703_244879 | 3300042636 | Bacteria | 60768 |
| 24 | Ga0466703_341561 | 3300042636 | Bacteria | 4921 |
| 25 | Ga0466704_063191 | 3300042643 | Bacteria | 120263 |
| 26 | Ga0466704_177597 | 3300042643 | Bacteria | 16687 |
| 27 | Ga0466704_336557 | 3300042643 | Bacteria | 19253 |
| 28 | Ga0466704_427413 | 3300042643 | Bacteria | 1836 |
| 29 | Ga0466713_070887 | 3300042602 | Bacteria | 102768 |
| 30 | Ga0466713_115642 | 3300042602 | Bacteria | 7093 |
| 31 | Ga0466711_361565 | 3300042615 | Bacteria | 30240 |
| 32 | Ga0466715_357759 | 3300042616 | Unclassified | 21940 |
| 33 | Ga0466715_595076 | 3300042616 | Unclassified | 3070 |
| 34 | Ga0466728_374130 | 3300042620 | Bacteria | 101360 |
| 35 | Ga0466728_417467 | 3300042620 | Bacteria | 43739 |
| 36 | Ga0466735_033768 | 3300042624 | Bacteria | 11738 |
| 37 | Ga0466735_188582 | 3300042624 | Bacteria | 13019 |
| 38 | Ga0466704_103604 | 3300042643 | Unclassified | 48325 |
| 39 | Ga0466709_217350 | 3300042648 | Bacteria | 27425 |
| 40 | Ga0466727_327534 | 3300042655 | Unclassified | 2792 |
| 41 | Ga0466706_074985 | 3300042599 | Bacteria | 164025 |
| 42 | Ga0068305_10000088 | 3300005083 | Bacteria | 28074 |
| 43 | Ga0466715_148118 | 3300042616 | Bacteria | 9851 |
| 44 | Ga0466715_163831 | 3300042616 | Bacteria | 66780 |
| 45 | Ga0466723_309907 | 3300042618 | Bacteria | 1578 |
| 46 | Ga0466726_310277 | 3300042619 | Bacteria | 6035 |
| 47 | Ga0466729_162297 | 3300042621 | Bacteria | 2135 |
| 48 | Ga0466729_166614 | 3300042621 | Bacteria | 4806 |
| 49 | Ga0466705_020073 | 3300042612 | Unclassified | 10438 |
| 50 | Ga0466705_097779 | 3300042612 | Bacteria | 23754 |
| 51 | Ga0466705_267397 | 3300042612 | Unclassified | 15072 |
| 52 | Ga0466690_111732 | 3300042590 | Unclassified | 4101 |
| 53 | Ga0466690_309270 | 3300042590 | Bacteria | 28660 |
| 54 | Ga0466735_011446 | 3300042624 | Bacteria | 29031 |
| 55 | Ga0466706_054498 | 3300042599 | Bacteria | 14342 |
| 56 | Ga0466719_130653 | 3300042606 | Bacteria | 158630 |
| 57 | Ga0466719_437791 | 3300042606 | Bacteria | 1569 |
| 58 | Ga0466715_598904 | 3300042616 | Bacteria | 23484 |
| 59 | Ga0466726_099748 | 3300042619 | Bacteria | 172717 |
| 60 | Ga0466735_051564 | 3300042624 | Bacteria | 12050 |
| 61 | Ga0466735_098736 | 3300042624 | Bacteria | 6188 |
| 62 | Ga0466703_110964 | 3300042636 | Bacteria | 165564 |
| 63 | Ga0466704_461472 | 3300042643 | Bacteria | 1292 |
| 64 | Ga0466714_017600 | 3300042603 | Bacteria | 1802 |
| 65 | Ga0466721_047583 | 3300042608 | Bacteria | 1390 |
| 66 | JGI24705J35276_12238773 | 3300002504 | Bacteria | 59736 |
| 67 | Ga0068305_10000474 | 3300005083 | Bacteria | 42561 |
| 68 | Ga0068305_10008008 | 3300005083 | Unclassified | 11143 |
| 69 | Ga0466723_117305 | 3300042618 | Unclassified | 10556 |
| 70 | Ga0466726_102143 | 3300042619 | Unclassified | 2456 |
| 71 | Ga0466726_301580 | 3300042619 | Unclassified | 1586 |
| 72 | Ga0466728_354629 | 3300042620 | Bacteria | 1026 |
| 73 | Ga0466690_055751 | 3300042590 | Bacteria | 148091 |
| 74 | Ga0123357_10139927 | 3300009784 | Bacteria | 2978 |
| 75 | Ga0123355_10365014 | 3300009826 | Bacteria | 1898 |
| 76 | Ga0123356_10351386 | 3300010049 | Bacteria | 1598 |
| 77 | Ga0466735_021788 | 3300042624 | Bacteria | 7554 |
| 78 | Ga0466735_103660 | 3300042624 | Bacteria | 5384 |
| 79 | Ga0466703_174672 | 3300042636 | Bacteria | 2319 |
| 80 | Ga0466704_318161 | 3300042643 | Unclassified | 3087 |
| 81 | Ga0466727_277884 | 3300042655 | Bacteria | 2724 |
| 82 | Ga0466707_134944 | 3300042601 | Bacteria | 69379 |
| 83 | Ga0466707_311871 | 3300042601 | Bacteria | 3461 |
| 84 | Ga0466719_040767 | 3300042606 | Bacteria | 242892 |
| 85 | JGI24702J35022_10001438 | 3300002462 | Bacteria | 14838 |
| 86 | Ga0068302_10011719 | 3300005071 | Bacteria | 6803 |
| 87 | Ga0466711_395000 | 3300042615 | Bacteria | 25038 |
| 88 | Ga0466711_420440 | 3300042615 | Bacteria | 1532 |
| 89 | Ga0466715_033549 | 3300042616 | Bacteria | 37880 |
| 90 | Ga0466723_009081 | 3300042618 | Bacteria | 7132 |
| 91 | Ga0466723_103339 | 3300042618 | Unclassified | 3621 |
| 92 | Ga0466729_119788 | 3300042621 | Bacteria | 59579 |
| 93 | Ga0466705_044778 | 3300042612 | Bacteria | 28249 |
| 94 | Ga0466705_163529 | 3300042612 | Bacteria | 36737 |
| 95 | Ga0466690_001780 | 3300042590 | Bacteria | 34391 |
| 96 | Ga0123357_10527746 | 3300009784 | Unclassified | 959 |
| 97 | Ga0123356_11448312 | 3300010049 | Bacteria | 846 |
| 98 | Ga0123353_12436822 | 3300010167 | Bacteria | 624 |
| 99 | Ga0466735_046368 | 3300042624 | Bacteria | 4099 |
| 100 | Ga0466704_502685 | 3300042643 | Bacteria | 17396 |
| 101 | Ga0466727_064201 | 3300042655 | Bacteria | 27422 |
| 102 | Ga0466706_004548 | 3300042599 | Bacteria | 42399 |
| 103 | Ga0466713_146898 | 3300042602 | Unclassified | 2668 |
| 104 | Ga0466719_221160 | 3300042606 | Unclassified | 22038 |
| 105 | 2227150543 | 2225789004 | Bacteria | 1590 |
| 106 | Ga0068302_10003229 | 3300005071 | Bacteria | 12896 |
| 107 | Ga0068302_10026904 | 3300005071 | Unclassified | 985 |
| 108 | Ga0068302_10331789 | 3300005071 | Bacteria | 1396 |
| 109 | Ga0466711_006581 | 3300042615 | Bacteria | 37124 |
| 110 | Ga0466711_189592 | 3300042615 | Unclassified | 2180 |
| 111 | Ga0466715_228458 | 3300042616 | Bacteria | 6125 |
| 112 | Ga0466715_436492 | 3300042616 | Bacteria | 169505 |
| 113 | Ga0466690_427242 | 3300042590 | Bacteria | 3363 |
| 114 | Ga0466735_058317 | 3300042624 | Bacteria | 7447 |
| 115 | Ga0466735_113700 | 3300042624 | Bacteria | 2478 |
| 116 | Ga0466727_298426 | 3300042655 | Bacteria | 81478 |
| 117 | Ga0466706_132446 | 3300042599 | Bacteria | 2125 |
| 118 | Ga0466707_077679 | 3300042601 | Bacteria | 32224 |
| 119 | Ga0466707_158829 | 3300042601 | Bacteria | 178149 |
| 120 | Ga0466713_011931 | 3300042602 | Bacteria | 21163 |
| 121 | Ga0466714_111952 | 3300042603 | Bacteria | 59763 |
| 122 | Ga0466716_189788 | 3300042605 | Bacteria | 17766 |
| 123 | Ga0466719_487307 | 3300042606 | Bacteria | 1067 |
| 124 | Ga0466705_419303 | 3300042612 | Unclassified | 2840 |
| 125 | Ga0466711_200800 | 3300042615 | Bacteria | 96997 |
| 126 | Ga0466711_372501 | 3300042615 | Bacteria | 489210 |
| 127 | Ga0466723_141698 | 3300042618 | Bacteria | 266684 |
| 128 | Ga0466726_020712 | 3300042619 | Unclassified | 1967 |
| 129 | Ga0466726_032706 | 3300042619 | Bacteria | 74064 |
| 130 | Ga0466726_349949 | 3300042619 | Bacteria | 10722 |
| 131 | Ga0466729_062888 | 3300042621 | Bacteria | 6911 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00436 | SSB | Single-strand binding protein family | 14 | 118 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00436 | GO:0003697 | single-stranded DNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.