Protein Family IF03412
Metagenome
Isolate
143
Members
68
Samples
116
Scaffolds
142.27
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_12136199|Ga0123353_121361991
- Length
- 161 aa
- Sequence
- MKRYGLSDKIVKVKFNKEQTYMTILPYVRKAQFYETDQMGVIHHSNYIRWFEEARVDFLEQAGFPYEKVESMGITLAVLGLSCEYKAPVVFGDTVHVQARPKACSHSRMSMDYEVMDAATGELRTTGETHHFFFRKEDARPVSLKKAIPELYDLFRSFMI*
Sample Types
Isolate
18.9%
Metagenome
81.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.2%
Unclassified
23.1%
Kalotermitidae
16.9%
Blattidae
9.2%
Tenebrionidae
6.2%
Drosophilidae
4.6%
Passalidae
3.1%
Termopsidae
3.1%
Vespidae
1.5%
Bombycidae
1.5%
Rhinotermitidae
1.5%
Taxonomy
Archaea
1
Bacteria
138
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 2 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 3 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 4 | 2820582954 | Unclassified Firmicutes Emb289P3bin119 | Isolate | Unclassified |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300005319 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut | Metagenome | Drosophilidae |
| 10 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 11 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 12 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 13 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 14 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 15 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 19 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 20 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 21 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 33 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 34 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 35 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 36 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 37 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 38 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 39 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 40 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 43 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 44 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 45 | 2820257794 | Unclassified Firmicutes Th196P3bin47 | Isolate | Unclassified |
| 46 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 47 | 2820373881 | Unclassified Firmicutes Nt197P3bin10 | Isolate | Unclassified |
| 48 | 2820463629 | Unclassified Firmicutes Lab288P3bin124 | Isolate | Unclassified |
| 49 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 50 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 51 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 52 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 53 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 54 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 55 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 56 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 57 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 58 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 59 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 60 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 61 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 62 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 63 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 64 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 65 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 66 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 67 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 68 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466714_007762 | 3300042603 | Bacteria | 3425 |
| 2 | Ga0466719_534721 | 3300042606 | Bacteria | 4603 |
| 3 | Ga0562378_0589 | 3300056814 | Bacteria | 58112 |
| 4 | Ga0123357_10504443 | 3300009784 | Bacteria | 1002 |
| 5 | Ga0123356_10010282 | 3300010049 | Bacteria | 9193 |
| 6 | Ga0123356_10031092 | 3300010049 | Bacteria | 4997 |
| 7 | Ga0123356_12122855 | 3300010049 | Bacteria | 702 |
| 8 | Ga0123353_10240665 | 3300010167 | Bacteria | 2812 |
| 9 | Ga0123353_11201124 | 3300010167 | Bacteria | 995 |
| 10 | Ga0123353_11584904 | 3300010167 | Bacteria | 828 |
| 11 | Ga0466712_017838 | 3300042614 | Bacteria | 2814 |
| 12 | Ga0466711_028838 | 3300042615 | Bacteria | 3859 |
| 13 | Ga0466703_030712 | 3300042636 | Bacteria | 23598 |
| 14 | Ga0466700_279896 | 3300042600 | Bacteria | 50851 |
| 15 | Ga0466714_096906 | 3300042603 | Bacteria | 1447 |
| 16 | Ga0466721_332798 | 3300042608 | Bacteria | 1201 |
| 17 | Ga0466722_228939 | 3300042609 | Bacteria | 13697 |
| 18 | Ga0562376_0927 | 3300056857 | Bacteria | 45710 |
| 19 | Ga0123357_10203980 | 3300009784 | Archaea | 2242 |
| 20 | Ga0123357_10774458 | 3300009784 | Bacteria | 658 |
| 21 | Ga0123355_10112807 | 3300009826 | Bacteria | 4242 |
| 22 | Ga0123355_11265486 | 3300009826 | Bacteria | 745 |
| 23 | Ga0123353_10573980 | 3300010167 | Unclassified | 1620 |
| 24 | Ga0466723_011522 | 3300042618 | Bacteria | 9062 |
| 25 | Ga0415639_000782 | 3300038395 | Bacteria | 15597 |
| 26 | Ga0415639_025418 | 3300038395 | Bacteria | 4058 |
| 27 | Ga0415639_132245 | 3300038395 | Bacteria | 4484 |
| 28 | Ga0466696_036444 | 3300042596 | Bacteria | 6356 |
| 29 | Ga0466699_193343 | 3300042597 | Bacteria | 1048 |
| 30 | Ga0466708_206063 | 3300042652 | Bacteria | 61475 |
| 31 | JGI24695J34938_10196709 | 3300002450 | Bacteria | 839 |
| 32 | Ga0466722_119174 | 3300042609 | Bacteria | 35813 |
| 33 | Ga0466722_210579 | 3300042609 | Bacteria | 3052 |
| 34 | Ga0466733_121626 | 3300042659 | Bacteria | 1123 |
| 35 | Ga0562374_0683 | 3300057007 | Bacteria | 50941 |
| 36 | Ga0123357_10907482 | 3300009784 | Bacteria | 568 |
| 37 | Ga0123356_10008372 | 3300010049 | Bacteria | 10283 |
| 38 | Ga0123356_10800353 | 3300010049 | Bacteria | 1114 |
| 39 | Ga0123356_10975879 | 3300010049 | Bacteria | 1018 |
| 40 | Ga0123353_10221582 | 3300010167 | Bacteria | 2957 |
| 41 | Ga0123353_10885307 | 3300010167 | Bacteria | 1218 |
| 42 | Ga0123353_11193839 | 3300010167 | Bacteria | 999 |
| 43 | Ga0466718_044170 | 3300042617 | Bacteria | 4468 |
| 44 | Ga0415639_001362 | 3300038395 | Bacteria | 26288 |
| 45 | Ga0466696_446307 | 3300042596 | Bacteria | 18945 |
| 46 | Ga0466704_470122 | 3300042643 | Bacteria | 6966 |
| 47 | Ga0466727_182730 | 3300042655 | Bacteria | 2200 |
| 48 | JGI24695J34938_10002049 | 3300002450 | Bacteria | 15900 |
| 49 | JGI24695J34938_10126093 | 3300002450 | Bacteria | 1043 |
| 50 | Ga0466700_283576 | 3300042600 | Bacteria | 6458 |
| 51 | Ga0123356_10000006 | 3300010049 | Bacteria | 247371 |
| 52 | Ga0123356_10013934 | 3300010049 | Bacteria | 7741 |
| 53 | Ga0123356_10202474 | 3300010049 | Bacteria | 2026 |
| 54 | Ga0123356_10839918 | 3300010049 | Bacteria | 1090 |
| 55 | Ga0123356_11446236 | 3300010049 | Bacteria | 846 |
| 56 | Ga0415639_000202 | 3300038395 | Bacteria | 104098 |
| 57 | Ga0415639_016078 | 3300038395 | Bacteria | 3943 |
| 58 | Ga0415639_045249 | 3300038395 | Unclassified | 4869 |
| 59 | Ga0466693_168798 | 3300042592 | Bacteria | 2537 |
| 60 | 2227507959 | 2225789004 | Bacteria | 65570 |
| 61 | JGI24695J34938_10016137 | 3300002450 | Bacteria | 3812 |
| 62 | JGI24702J35022_10095146 | 3300002462 | Bacteria | 1625 |
| 63 | Ga0466719_045961 | 3300042606 | Bacteria | 1863 |
| 64 | Ga0466721_084896 | 3300042608 | Bacteria | 14749 |
| 65 | Ga0123353_10000551 | 3300010167 | Bacteria | 46124 |
| 66 | Ga0123353_10581246 | 3300010167 | Bacteria | 1607 |
| 67 | Ga0415639_281494 | 3300038395 | Bacteria | 1757 |
| 68 | Ga0466708_353409 | 3300042652 | Bacteria | 7207 |
| 69 | Ga0105553_1110576 | 3300007767 | Bacteria | 4135 |
| 70 | Ga0466700_053694 | 3300042600 | Bacteria | 1270 |
| 71 | Ga0466717_137760 | 3300042604 | Bacteria | 1296 |
| 72 | Ga0123356_10236061 | 3300010049 | Bacteria | 1896 |
| 73 | Ga0123356_11039157 | 3300010049 | Bacteria | 989 |
| 74 | Ga0123353_10093178 | 3300010167 | Bacteria | 4854 |
| 75 | Ga0123353_10093921 | 3300010167 | Bacteria | 4833 |
| 76 | Ga0123353_10725664 | 3300010167 | Bacteria | 1389 |
| 77 | Ga0123354_10368244 | 3300010882 | Bacteria | 1257 |
| 78 | Ga0466711_212527 | 3300042615 | Bacteria | 14136 |
| 79 | Ga0466715_417946 | 3300042616 | Bacteria | 1368 |
| 80 | Ga0415639_067238 | 3300038395 | Bacteria | 19616 |
| 81 | 2227155809 | 2225789004 | Bacteria | 8449 |
| 82 | JGI24695J34938_10000001 | 3300002450 | Bacteria | 290906 |
| 83 | Ga0466714_012954 | 3300042603 | Bacteria | 18148 |
| 84 | Ga0466717_302819 | 3300042604 | Bacteria | 3553 |
| 85 | Ga0562378_0039 | 3300056814 | Bacteria | 444185 |
| 86 | Ga0562375_0159 | 3300056856 | Bacteria | 198506 |
| 87 | Ga0123357_10161878 | 3300009784 | Bacteria | 2680 |
| 88 | Ga0123356_10024576 | 3300010049 | Bacteria | 5668 |
| 89 | Ga0123356_10048288 | 3300010049 | Bacteria | 3961 |
| 90 | Ga0123353_10841725 | 3300010167 | Unclassified | 1259 |
| 91 | Ga0123353_11908010 | 3300010167 | Bacteria | 732 |
| 92 | Ga0466705_389509 | 3300042612 | Bacteria | 5824 |
| 93 | Ga0466690_156306 | 3300042590 | Bacteria | 2349 |
| 94 | Ga0466693_143708 | 3300042592 | Bacteria | 4562 |
| 95 | Ga0466703_400018 | 3300042636 | Bacteria | 6355 |
| 96 | Ga0466725_042710 | 3300042654 | Bacteria | 6913 |
| 97 | IMNBL1DRAFT_c0000867 | 3300000062 | Bacteria | 23600 |
| 98 | Ga0466705_118955 | 3300042612 | Bacteria | 7950 |
| 99 | Ga0123355_10297395 | 3300009826 | Bacteria | 2206 |
| 100 | Ga0123355_10579376 | 3300009826 | Bacteria | 1342 |
| 101 | Ga0123356_10302559 | 3300010049 | Bacteria | 1705 |
| 102 | Ga0123356_10546201 | 3300010049 | Bacteria | 1319 |
| 103 | Ga0123356_11243233 | 3300010049 | Bacteria | 910 |
| 104 | Ga0123356_12740076 | 3300010049 | Bacteria | 617 |
| 105 | Ga0123353_10253273 | 3300010167 | Bacteria | 2725 |
| 106 | Ga0123353_10255061 | 3300010167 | Bacteria | 2713 |
| 107 | Ga0123353_11233989 | 3300010167 | Bacteria | 978 |
| 108 | Ga0123353_12136199 | 3300010167 | Bacteria | 680 |
| 109 | Ga0466715_428262 | 3300042616 | Bacteria | 3771 |
| 110 | Ga0466726_286329 | 3300042619 | Bacteria | 1942 |
| 111 | Ga0466691_032537 | 3300042593 | Bacteria | 5007 |
| 112 | Ga0466724_37783 | 3300042649 | Bacteria | 3697 |
| 113 | IMNBL1DRAFT_c0000033 | 3300000062 | Bacteria | 123013 |
| 114 | JGI24695J34938_10029829 | 3300002450 | Bacteria | 2546 |
| 115 | JGI24695J34938_10048380 | 3300002450 | Unclassified | 1873 |
| 116 | Ga0074304_1173717 | 3300005319 | Bacteria | 651 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.