Protein Family IF03390
Metagenome
Metatranscriptome
Isolate
148
Members
44
Samples
137
Scaffolds
111.78
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_11333831|Ga0123353_113338313
- Length
- 137 aa
- Sequence
- LKIYLPDFQVSGILVIQIDAVIDNDGVLRTCKASGHAGAGKAGNDIVCAAVSVLMRTACSILSGRKGIVLHYGAPEKGQMWLNVDYKADGKDFLNTSGLFLIEGLRSVAQEYPKNCKLDLVIRRNCYGKKKRRKRR*
Sample Types
Isolate
7.4%
Metagenome
91.9%
MAG
0.0%
Metatranscriptome
0.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.6%
Unclassified
26.2%
Kalotermitidae
19.0%
Rhinotermitidae
4.8%
Termopsidae
2.4%
Taxonomy
Archaea
0
Bacteria
140
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 10 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 11 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 12 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 22 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 25 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 28 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 29 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 33 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 34 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 35 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 36 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 37 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 38 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 39 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 40 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 43 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 44 | 3300021220 | Termite gut microbial communities from nest from French Guiana - FG16_9_6 mRNA SA | Metatranscriptome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466709_069319 | 3300042648 | Bacteria | 1187 |
| 2 | Ga0415639_116889 | 3300038395 | Bacteria | 5852 |
| 3 | Ga0466699_099103 | 3300042597 | Bacteria | 4184 |
| 4 | Ga0466699_114179 | 3300042597 | Bacteria | 5961 |
| 5 | Ga0466699_206786 | 3300042597 | Bacteria | 2770 |
| 6 | Ga0123356_10000240 | 3300010049 | Bacteria | 63107 |
| 7 | Ga0123356_11871498 | 3300010049 | Bacteria | 747 |
| 8 | Ga0123356_12653770 | 3300010049 | Bacteria | 627 |
| 9 | Ga0123353_11033412 | 3300010167 | Bacteria | 1100 |
| 10 | JGI24698J34947_10000080 | 3300002449 | Bacteria | 31361 |
| 11 | JGI24698J34947_10182852 | 3300002449 | Bacteria | 836 |
| 12 | Ga0072941_1002368 | 3300005201 | Bacteria | 28238 |
| 13 | Ga0072941_1005321 | 3300005201 | Bacteria | 18099 |
| 14 | Ga0072941_1009212 | 3300005201 | Bacteria | 12195 |
| 15 | Ga0072941_1017224 | 3300005201 | Bacteria | 17207 |
| 16 | Ga0466705_197661 | 3300042612 | Bacteria | 2580 |
| 17 | Ga0466702_078035 | 3300042635 | Bacteria | 18489 |
| 18 | Ga0466702_329253 | 3300042635 | Bacteria | 4973 |
| 19 | Ga0466693_005450 | 3300042592 | Bacteria | 32375 |
| 20 | Ga0466694_166314 | 3300042594 | Bacteria | 23774 |
| 21 | Ga0466712_037661 | 3300042614 | Bacteria | 33888 |
| 22 | Ga0466726_344916 | 3300042619 | Bacteria | 3834 |
| 23 | Ga0123355_11317870 | 3300009826 | Bacteria | 723 |
| 24 | Ga0123356_10001636 | 3300010049 | Unclassified | 24590 |
| 25 | Ga0123356_10034993 | 3300010049 | Bacteria | 4694 |
| 26 | Ga0123356_10621903 | 3300010049 | Bacteria | 1246 |
| 27 | Ga0123356_11932201 | 3300010049 | Bacteria | 735 |
| 28 | Ga0123353_11558358 | 3300010167 | Bacteria | 837 |
| 29 | Ga0466721_030595 | 3300042608 | Bacteria | 2136 |
| 30 | JGI24698J34947_10207384 | 3300002449 | Bacteria | 762 |
| 31 | JGI24695J34938_10000766 | 3300002450 | Bacteria | 30215 |
| 32 | JGI24695J34938_10002280 | 3300002450 | Bacteria | 14811 |
| 33 | JGI24695J34938_10002475 | 3300002450 | Bacteria | 14085 |
| 34 | JGI24695J34938_10005192 | 3300002450 | Bacteria | 8225 |
| 35 | JGI24695J34938_10011082 | 3300002450 | Bacteria | 4882 |
| 36 | JGI24695J34938_10084719 | 3300002450 | Bacteria | 1306 |
| 37 | JGI24695J34938_10160483 | 3300002450 | Bacteria | 924 |
| 38 | Ga0466702_447581 | 3300042635 | Bacteria | 27549 |
| 39 | Ga0456237_0004725 | 3300041968 | Bacteria | 2181 |
| 40 | Ga0466712_040231 | 3300042614 | Bacteria | 12213 |
| 41 | Ga0466712_248012 | 3300042614 | Bacteria | 7175 |
| 42 | Ga0466723_155445 | 3300042618 | Bacteria | 27422 |
| 43 | Ga0466728_043071 | 3300042620 | Unclassified | 1360 |
| 44 | Ga0123356_10084251 | 3300010049 | Bacteria | 3012 |
| 45 | Ga0123356_10110077 | 3300010049 | Bacteria | 2659 |
| 46 | Ga0123356_10545492 | 3300010049 | Bacteria | 1320 |
| 47 | Ga0123356_13090102 | 3300010049 | Bacteria | 580 |
| 48 | Ga0123353_11258265 | 3300010167 | Bacteria | 965 |
| 49 | Ga0123353_11333831 | 3300010167 | Bacteria | 928 |
| 50 | AustNasuHG_c1018060 | 3300000089 | Bacteria | 2333 |
| 51 | JGI24695J34938_10000523 | 3300002450 | Bacteria | 37385 |
| 52 | JGI24695J34938_10003864 | 3300002450 | Bacteria | 10144 |
| 53 | JGI24695J34938_10021463 | 3300002450 | Bacteria | 3157 |
| 54 | JGI24695J34938_10241778 | 3300002450 | Unclassified | 763 |
| 55 | JGI24695J34938_10458996 | 3300002450 | Bacteria | 577 |
| 56 | JGI24700J35501_10930500 | 3300002508 | Bacteria | 14760 |
| 57 | Ga0466730_074010 | 3300042625 | Bacteria | 1655 |
| 58 | Ga0466702_349661 | 3300042635 | Bacteria | 1275 |
| 59 | Ga0466699_257329 | 3300042597 | Bacteria | 15190 |
| 60 | Ga0466712_028735 | 3300042614 | Bacteria | 38990 |
| 61 | Ga0466711_229884 | 3300042615 | Bacteria | 15610 |
| 62 | Ga0466718_065755 | 3300042617 | Unclassified | 14643 |
| 63 | Ga0123356_10642852 | 3300010049 | Bacteria | 1228 |
| 64 | Ga0123356_11439569 | 3300010049 | Bacteria | 848 |
| 65 | Ga0123356_11829245 | 3300010049 | Bacteria | 755 |
| 66 | Ga0466722_268221 | 3300042609 | Bacteria | 3046 |
| 67 | JGI24698J34947_10012322 | 3300002449 | Unclassified | 4686 |
| 68 | JGI24698J34947_10022118 | 3300002449 | Bacteria | 3412 |
| 69 | JGI24698J34947_10071450 | 3300002449 | Bacteria | 1666 |
| 70 | JGI24695J34938_10000133 | 3300002450 | Bacteria | 67517 |
| 71 | JGI24695J34938_10021345 | 3300002450 | Bacteria | 3169 |
| 72 | JGI24695J34938_10049665 | 3300002450 | Bacteria | 1843 |
| 73 | Ga0072941_1067780 | 3300005201 | Bacteria | 5030 |
| 74 | Ga0466702_066735 | 3300042635 | Bacteria | 2237 |
| 75 | Ga0466702_290191 | 3300042635 | Bacteria | 2194 |
| 76 | Ga0415639_149528 | 3300038395 | Bacteria | 5279 |
| 77 | Ga0466690_311860 | 3300042590 | Bacteria | 2358 |
| 78 | Ga0466693_004183 | 3300042592 | Bacteria | 23210 |
| 79 | Ga0466699_276206 | 3300042597 | Bacteria | 9001 |
| 80 | Ga0123356_10276907 | 3300010049 | Bacteria | 1771 |
| 81 | Ga0123356_11944460 | 3300010049 | Bacteria | 733 |
| 82 | Ga0123353_10661223 | 3300010167 | Bacteria | 1476 |
| 83 | Ga0466722_122333 | 3300042609 | Bacteria | 1667 |
| 84 | AustNasuHG_c1057225 | 3300000089 | Bacteria | 780 |
| 85 | JGI24698J34947_10045544 | 3300002449 | Bacteria | 2237 |
| 86 | JGI24698J34947_10230053 | 3300002449 | Bacteria | 705 |
| 87 | JGI24695J34938_10000762 | 3300002450 | Bacteria | 30258 |
| 88 | JGI24695J34938_10002574 | 3300002450 | Bacteria | 13680 |
| 89 | JGI24695J34938_10008880 | 3300002450 | Bacteria | 5676 |
| 90 | JGI24695J34938_10405670 | 3300002450 | Bacteria | 608 |
| 91 | Ga0466702_094475 | 3300042635 | Bacteria | 3120 |
| 92 | Ga0466709_412539 | 3300042648 | Bacteria | 6486 |
| 93 | Ga0223680_119515 | 3300021220 | Bacteria | 618 |
| 94 | Ga0466712_227966 | 3300042614 | Bacteria | 8768 |
| 95 | Ga0466718_163599 | 3300042617 | Unclassified | 5068 |
| 96 | Ga0123356_10000673 | 3300010049 | Bacteria | 37817 |
| 97 | Ga0123356_10004344 | 3300010049 | Bacteria | 14657 |
| 98 | Ga0123356_10020848 | 3300010049 | Bacteria | 6199 |
| 99 | Ga0123356_10058838 | 3300010049 | Bacteria | 3584 |
| 100 | Ga0123356_10294373 | 3300010049 | Bacteria | 1725 |
| 101 | JGI24698J34947_10000117 | 3300002449 | Bacteria | 28041 |
| 102 | JGI24698J34947_10112715 | 3300002449 | Bacteria | 1197 |
| 103 | JGI24695J34938_10000517 | 3300002450 | Bacteria | 37577 |
| 104 | JGI24695J34938_10000637 | 3300002450 | Bacteria | 33482 |
| 105 | JGI24695J34938_10018388 | 3300002450 | Bacteria | 3496 |
| 106 | JGI24695J34938_10242277 | 3300002450 | Unclassified | 763 |
| 107 | Ga0466731_108144 | 3300042622 | Bacteria | 2119 |
| 108 | Ga0466708_163864 | 3300042652 | Bacteria | 25092 |
| 109 | Ga0466694_118650 | 3300042594 | Bacteria | 7112 |
| 110 | Ga0466712_106452 | 3300042614 | Bacteria | 3441 |
| 111 | Ga0466715_301795 | 3300042616 | Bacteria | 1342 |
| 112 | Ga0123356_10653964 | 3300010049 | Bacteria | 1218 |
| 113 | Ga0123356_12087320 | 3300010049 | Bacteria | 708 |
| 114 | Ga0123353_11846470 | 3300010167 | Bacteria | 748 |
| 115 | Ga0466722_041082 | 3300042609 | Bacteria | 5572 |
| 116 | Ga0466722_091443 | 3300042609 | Bacteria | 1376 |
| 117 | JGI24702J35022_10489542 | 3300002462 | Bacteria | 753 |
| 118 | Ga0466732_344423 | 3300042656 | Bacteria | 1174 |
| 119 | Ga0415639_004327 | 3300038395 | Bacteria | 8445 |
| 120 | Ga0415639_034121 | 3300038395 | Bacteria | 6028 |
| 121 | Ga0466693_026794 | 3300042592 | Unclassified | 1115 |
| 122 | Ga0466694_251773 | 3300042594 | Bacteria | 56431 |
| 123 | Ga0466699_027140 | 3300042597 | Bacteria | 1158 |
| 124 | Ga0466718_077611 | 3300042617 | Bacteria | 3009 |
| 125 | Ga0466718_078288 | 3300042617 | Bacteria | 22152 |
| 126 | Ga0123355_10295852 | 3300009826 | Bacteria | 2214 |
| 127 | Ga0123356_10202683 | 3300010049 | Bacteria | 2025 |
| 128 | Ga0123353_10053328 | 3300010167 | Bacteria | 6463 |
| 129 | Ga0123353_12645347 | 3300010167 | Bacteria | 592 |
| 130 | Ga0466700_009963 | 3300042600 | Bacteria | 1424 |
| 131 | JGI24698J34947_10000264 | 3300002449 | Bacteria | 22404 |
| 132 | JGI24698J34947_10021770 | 3300002449 | Bacteria | 3445 |
| 133 | JGI24695J34938_10001095 | 3300002450 | Bacteria | 24483 |
| 134 | JGI24695J34938_10002277 | 3300002450 | Bacteria | 14816 |
| 135 | JGI24695J34938_10319126 | 3300002450 | Bacteria | 675 |
| 136 | JGI24695J34938_10368488 | 3300002450 | Bacteria | 635 |
| 137 | JGI24695J34938_10378668 | 3300002450 | Bacteria | 627 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04327 | Peptidase_Prp | Cysteine protease Prp | 17 | 117 | 0.79 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.