Protein Family IF03304
Metagenome
Isolate
151
Members
91
Samples
115
Scaffolds
262.28
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10479639|Ga0123353_104796392
- Length
- 297 aa
- Sequence
- VKLSRAVYKGKICENAACLLDFSNMNDMESIIIFKIGGNVIDHPPTLEAVLSDFAAWQNRKILVHGGGKIASKLMIKLGIVPKMVDGRRITDRETLEVVTMAYAGLINKNIVAAIQRHGCNAIGLTGADANLITAVKRPVKDIDYGFVGDLNPECISVNTLINFVNSGLVPVIAPITHDGSGLLLNTNADTIASNLAIALAKTFRVQLVFCFEKKGVLRNPDDEQSVIDFLDEALYQQYRDEGVITAGMIPKLDNAFAALHSGVAEVRICNHENLNSGTKINRSQPVITGRIVVDE*
Sample Types
Isolate
23.8%
Metagenome
76.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
20.5%
Cryptocercidae
13.3%
Culicidae
10.8%
Kalotermitidae
8.4%
Armadillidiidae
8.4%
Cicadellidae
6.0%
Unclassified
4.8%
Elmidae
4.8%
Rhinotermitidae
2.4%
Passalidae
2.4%
Termopsidae
2.4%
Formicidae
2.4%
Drosophilidae
2.4%
Corydiidae
2.4%
Hodotermitidae
1.2%
Cambaridae
1.2%
Blattellidae
1.2%
Hydrophilidae
1.2%
Aphrophoridae
1.2%
Daphniidae
1.2%
Apidae
1.2%
Taxonomy
Archaea
1
Bacteria
146
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2833034481 | Blattabacterium punctulatus CPUwf | Isolate | Cryptocercidae |
| 2 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 6 | 638341057 | Candidatus Sulcia muelleri Hc | Isolate | Cicadellidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 10 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 11 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 12 | 2833030225 | Blattabacterium punctulatus CPUmp | Isolate | Cryptocercidae |
| 13 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 14 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 17 | 646564518 | Candidatus Sulcia muelleri DMIN (unscreened) | Isolate | Cicadellidae |
| 18 | 648028014 | Candidatus Sulcia muelleri CARI | Isolate | Unclassified |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 2833044002 | Blattabacterium punctulatus CPUbr | Isolate | Cryptocercidae |
| 27 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 28 | 2511231112 | Blattabacterium punctulatus Cpu | Isolate | Cryptocercidae |
| 29 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 30 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 31 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 32 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 33 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 34 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 35 | 2833033875 | Blattabacterium punctulatus CPUpc | Isolate | Cryptocercidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 40 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 41 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 42 | 2833043393 | Blattabacterium clevelandi CCLhc | Isolate | Cryptocercidae |
| 43 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 44 | 2599185120 | Candidatus Sulcia muelleri BGSS | Isolate | Cicadellidae |
| 45 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 48 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 49 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 50 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 51 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 52 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 53 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 54 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 55 | 2718218185 | Candidatus Sulcia muelleri NC | Isolate | Cicadellidae |
| 56 | 3002026852 | Blattabacterium cuenoti BEYBkur | Isolate | Blattellidae |
| 57 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 58 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 59 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 60 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 61 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 62 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 63 | 2833037493 | Blattabacterium punctulatus CPUsv | Isolate | Cryptocercidae |
| 64 | 2833042786 | Blattabacterium punctulatus CPUsm | Isolate | Cryptocercidae |
| 65 | 2833051446 | Blattabacterium punctulatus CPUml | Isolate | Cryptocercidae |
| 66 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 67 | 641228484 | Candidatus Sulcia muelleri GWSS | Isolate | Cicadellidae |
| 68 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 69 | 3002032411 | Blattabacterium cuenoti POLYPHAGsp | Isolate | Corydiidae |
| 70 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 71 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 72 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 73 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 74 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 75 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 76 | 3002004002 | Blattabacterium cuenoti EUPOLsin | Isolate | Corydiidae |
| 77 | 2833047020 | Blattabacterium punctulatus CPUbt | Isolate | Cryptocercidae |
| 78 | 2833050843 | Blattabacterium punctulatus CPUmc | Isolate | Cryptocercidae |
| 79 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 80 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 81 | 2510917001 | Candidatus Sulcia muelleri PSPU | Isolate | Aphrophoridae |
| 82 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 83 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 84 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 85 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 86 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 87 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 88 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 89 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 90 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 91 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_207009 | 3300042659 | Bacteria | 10181 |
| 2 | Ga0123357_10103460 | 3300009784 | Bacteria | 3662 |
| 3 | Ga0123357_10112694 | 3300009784 | Bacteria | 3460 |
| 4 | Ga0123356_10282610 | 3300010049 | Bacteria | 1756 |
| 5 | Ga0123356_11029838 | 3300010049 | Bacteria | 993 |
| 6 | Ga0123353_10479639 | 3300010167 | Bacteria | 1820 |
| 7 | Ga0123354_10005802 | 3300010882 | Bacteria | 18105 |
| 8 | Ga0160464_103719 | 3300012805 | Bacteria | 2097 |
| 9 | Ga0160441_100064 | 3300012825 | Bacteria | 139665 |
| 10 | Ga0265387_1001492 | 3300024582 | Bacteria | 3432 |
| 11 | Ga0466657_244006 | 3300042582 | Bacteria | 1020 |
| 12 | 2227513552 | 2225789004 | Bacteria | 3501 |
| 13 | Ga0102734_1003017 | 3300007129 | Bacteria | 4318 |
| 14 | Ga0466700_002804 | 3300042600 | Bacteria | 7874 |
| 15 | Ga0466733_177143 | 3300042659 | Bacteria | 3601 |
| 16 | Ga0466708_023087 | 3300042652 | Bacteria | 8254 |
| 17 | Ga0123357_10237885 | 3300009784 | Bacteria | 1979 |
| 18 | Ga0123353_10188622 | 3300010167 | Bacteria | 3257 |
| 19 | Ga0123353_10660217 | 3300010167 | Bacteria | 1478 |
| 20 | Ga0160453_100018 | 3300012814 | Bacteria | 253724 |
| 21 | Ga0160433_100152 | 3300012846 | Bacteria | 59634 |
| 22 | Ga0160434_100107 | 3300012850 | Bacteria | 49722 |
| 23 | Ga0160436_1005051 | 3300012861 | Bacteria | 3115 |
| 24 | Ga0466696_250156 | 3300042596 | Bacteria | 2357 |
| 25 | 2227510475 | 2225789004 | Bacteria | 3572 |
| 26 | Ga0466715_295221 | 3300042616 | Bacteria | 21128 |
| 27 | Ga0466715_462246 | 3300042616 | Bacteria | 5559 |
| 28 | Ga0466726_379868 | 3300042619 | Bacteria | 5327 |
| 29 | Ga0466717_024600 | 3300042604 | Bacteria | 3222 |
| 30 | Ga0466719_165796 | 3300042606 | Bacteria | 8509 |
| 31 | Ga0466722_125067 | 3300042609 | Bacteria | 1441 |
| 32 | Ga0466698_425211 | 3300042610 | Bacteria | 1076 |
| 33 | Ga0466733_107402 | 3300042659 | Bacteria | 5275 |
| 34 | Ga0466733_207631 | 3300042659 | Bacteria | 3177 |
| 35 | Ga0466734_163987 | 3300042623 | Bacteria | 9064 |
| 36 | Ga0123354_10133971 | 3300010882 | Bacteria | 3110 |
| 37 | Ga0160469_100021 | 3300012824 | Bacteria | 326466 |
| 38 | Ga0160469_101374 | 3300012824 | Bacteria | 6655 |
| 39 | Ga0160455_100062 | 3300012837 | Bacteria | 204480 |
| 40 | Ga0160445_100054 | 3300012847 | Bacteria | 132397 |
| 41 | Ga0160457_1001207 | 3300012858 | Bacteria | 7808 |
| 42 | JGI24699J35502_11133850 | 3300002509 | Bacteria | 17080 |
| 43 | Ga0104045_1005804 | 3300007085 | Bacteria | 3437 |
| 44 | Ga0466713_030735 | 3300042602 | Bacteria | 2173 |
| 45 | Ga0466713_046052 | 3300042602 | Bacteria | 2669 |
| 46 | Ga0466714_138438 | 3300042603 | Bacteria | 3093 |
| 47 | Ga0123353_10347987 | 3300010167 | Bacteria | 2235 |
| 48 | Ga0123354_10017809 | 3300010882 | Bacteria | 11129 |
| 49 | Ga0123354_10510663 | 3300010882 | Bacteria | 930 |
| 50 | Ga0160460_100045 | 3300012845 | Bacteria | 232961 |
| 51 | Ga0160433_100012 | 3300012846 | Bacteria | 265415 |
| 52 | Ga0160435_1000020 | 3300012857 | Bacteria | 147036 |
| 53 | Ga0466692_025449 | 3300042591 | Bacteria | 12448 |
| 54 | Ga0466700_082314 | 3300042600 | Bacteria | 2058 |
| 55 | Ga0466714_052255 | 3300042603 | Bacteria | 17302 |
| 56 | Ga0466697_134583 | 3300042611 | Bacteria | 2183 |
| 57 | Ga0466734_086063 | 3300042623 | Bacteria | 1137 |
| 58 | Ga0466735_225132 | 3300042624 | Bacteria | 8588 |
| 59 | Ga0466708_083951 | 3300042652 | Bacteria | 21435 |
| 60 | Ga0123357_10076475 | 3300009784 | Bacteria | 4420 |
| 61 | Ga0123357_10156346 | 3300009784 | Bacteria | 2749 |
| 62 | Ga0123357_10174153 | 3300009784 | Bacteria | 2535 |
| 63 | Ga0123356_10022111 | 3300010049 | Bacteria | 6006 |
| 64 | Ga0123354_10045541 | 3300010882 | Bacteria | 6713 |
| 65 | Ga0123354_10065817 | 3300010882 | Bacteria | 5300 |
| 66 | Ga0123354_10122526 | 3300010882 | Bacteria | 3346 |
| 67 | Ga0123354_10369785 | 3300010882 | Bacteria | 1252 |
| 68 | Ga0160445_107263 | 3300012847 | Bacteria | 1761 |
| 69 | Ga0466692_053965 | 3300042591 | Bacteria | 14214 |
| 70 | Ga0466691_017179 | 3300042593 | Bacteria | 4469 |
| 71 | Ga0466691_039436 | 3300042593 | Bacteria | 9462 |
| 72 | Ga0466696_097705 | 3300042596 | Bacteria | 18993 |
| 73 | Ga0103264_1000022 | 3300007188 | Bacteria | 178022 |
| 74 | Ga0123357_10002170 | 3300009784 | Bacteria | 21623 |
| 75 | Ga0466711_049656 | 3300042615 | Bacteria | 7333 |
| 76 | Ga0466711_131930 | 3300042615 | Bacteria | 6622 |
| 77 | Ga0466714_031498 | 3300042603 | Bacteria | 6892 |
| 78 | Ga0466714_040333 | 3300042603 | Bacteria | 3417 |
| 79 | Ga0466733_099338 | 3300042659 | Bacteria | 1443 |
| 80 | Ga0466733_149748 | 3300042659 | Unclassified | 1092 |
| 81 | Ga0123357_10005383 | 3300009784 | Bacteria | 15315 |
| 82 | Ga0123354_10097237 | 3300010882 | Bacteria | 4014 |
| 83 | Ga0160468_100141 | 3300012819 | Unclassified | 67795 |
| 84 | Ga0160457_1001115 | 3300012858 | Bacteria | 8337 |
| 85 | Ga0466657_172892 | 3300042582 | Bacteria | 3836 |
| 86 | Meta3P_1008364 | 3300002464 | Bacteria | 6575 |
| 87 | Ga0466713_137226 | 3300042602 | Bacteria | 80436 |
| 88 | Ga0466714_170292 | 3300042603 | Unclassified | 1210 |
| 89 | Ga0466719_034925 | 3300042606 | Bacteria | 7896 |
| 90 | Ga0466724_59158 | 3300042649 | Bacteria | 434991 |
| 91 | Ga0123357_10397384 | 3300009784 | Bacteria | 1259 |
| 92 | Ga0160445_100027 | 3300012847 | Bacteria | 190794 |
| 93 | Ga0160443_100103 | 3300012848 | Bacteria | 135933 |
| 94 | Ga0160443_101432 | 3300012848 | Unclassified | 8083 |
| 95 | Ga0466692_168579 | 3300042591 | Bacteria | 1995 |
| 96 | IMNBGM34_c000764 | 3300000036 | Bacteria | 7541 |
| 97 | Ga0104045_1027581 | 3300007085 | Bacteria | 3284 |
| 98 | Ga0466713_152224 | 3300042602 | Bacteria | 8280 |
| 99 | Ga0466731_252691 | 3300042622 | Bacteria | 2826 |
| 100 | Ga0466735_064509 | 3300042624 | Bacteria | 16715 |
| 101 | Ga0466730_053826 | 3300042625 | Bacteria | 92011 |
| 102 | Ga0466703_398874 | 3300042636 | Archaea | 2125 |
| 103 | Ga0466725_198172 | 3300042654 | Bacteria | 1365 |
| 104 | Ga0123356_10078120 | 3300010049 | Bacteria | 3123 |
| 105 | Ga0123356_11096443 | 3300010049 | Bacteria | 964 |
| 106 | Ga0123353_10735815 | 3300010167 | Bacteria | 1376 |
| 107 | Ga0123354_10093559 | 3300010882 | Bacteria | 4131 |
| 108 | Ga0160466_100006 | 3300012809 | Bacteria | 498369 |
| 109 | Ga0160430_100584 | 3300012852 | Bacteria | 18773 |
| 110 | Ga0068305_10000087 | 3300005083 | Bacteria | 586632 |
| 111 | Ga0104048_1002413 | 3300007143 | Bacteria | 15419 |
| 112 | Ga0123357_10000306 | 3300009784 | Bacteria | 46839 |
| 113 | Ga0466706_002092 | 3300042599 | Bacteria | 2347 |
| 114 | Ga0466713_080175 | 3300042602 | Bacteria | 2580 |
| 115 | Ga0466698_091855 | 3300042610 | Bacteria | 3484 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00696 | AA_kinase | Amino acid kinase family | 31 | 271 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.