Protein Family IF03297
Metagenome
Isolate
168
Members
44
Samples
157
Scaffolds
122.36
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10458310|Ga0123353_104583102
- Length
- 130 aa
- Sequence
- MSKRNKLIQKKLEYYMNLPYTFIIEWSDVDKCFLGSIIELEKNMTCGQTREEVFNNLKEALVSYVKTSIDNNMEIPEPIKIDDFKGSITYRTSKERHYRLAKIAKLNGKSINAFIDEAIGDKLKEAIQG*
Sample Types
Isolate
6.5%
Metagenome
93.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
70.7%
Unclassified
26.8%
Kalotermitidae
2.4%
Taxonomy
Archaea
0
Bacteria
143
Eukaryota
0
Viruses
0
Unclassified
25
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 3 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 4 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 5 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 6 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 16 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 21 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 22 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 23 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 24 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 25 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 26 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 27 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 28 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 29 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 30 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 31 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 32 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 33 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 34 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 35 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 39 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 40 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 41 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 44 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_120186 | 3300042656 | Bacteria | 1087 |
| 2 | Ga0466714_057559 | 3300042603 | Bacteria | 1167 |
| 3 | Ga0466720_165062 | 3300042607 | Bacteria | 2276 |
| 4 | Ga0466712_186176 | 3300042614 | Bacteria | 7370 |
| 5 | Ga0466712_246868 | 3300042614 | Unclassified | 1966 |
| 6 | Ga0466718_160908 | 3300042617 | Unclassified | 4448 |
| 7 | Ga0264413_105879 | 3300024493 | Bacteria | 7074 |
| 8 | Ga0466690_197369 | 3300042590 | Unclassified | 2646 |
| 9 | JGI24698J34947_10024370 | 3300002449 | Bacteria | 3231 |
| 10 | JGI24698J34947_10041952 | 3300002449 | Bacteria | 2353 |
| 11 | JGI24698J34947_10089175 | 3300002449 | Bacteria | 1421 |
| 12 | JGI24695J34938_10005708 | 3300002450 | Bacteria | 7680 |
| 13 | JGI24695J34938_10048042 | 3300002450 | Bacteria | 1881 |
| 14 | JGI24702J35022_10247571 | 3300002462 | Bacteria | 1036 |
| 15 | Ga0123357_10000344 | 3300009784 | Bacteria | 43911 |
| 16 | Ga0123355_10133162 | 3300009826 | Bacteria | 3825 |
| 17 | Ga0123355_10247812 | 3300009826 | Bacteria | 2513 |
| 18 | Ga0123356_10000104 | 3300010049 | Bacteria | 89487 |
| 19 | Ga0123356_10731261 | 3300010049 | Bacteria | 1159 |
| 20 | Ga0123353_10357672 | 3300010167 | Bacteria | 2196 |
| 21 | Ga0123353_10509388 | 3300010167 | Bacteria | 1750 |
| 22 | Ga0466720_014693 | 3300042607 | Bacteria | 2525 |
| 23 | Ga0466720_048528 | 3300042607 | Unclassified | 2889 |
| 24 | Ga0466718_108758 | 3300042617 | Unclassified | 3101 |
| 25 | Ga0466718_152253 | 3300042617 | Bacteria | 5162 |
| 26 | Ga0415639_035098 | 3300038395 | Unclassified | 3535 |
| 27 | JGI24698J34947_10001983 | 3300002449 | Bacteria | 10923 |
| 28 | Ga0072941_1023363 | 3300005201 | Bacteria | 6856 |
| 29 | Ga0123357_10164424 | 3300009784 | Unclassified | 2648 |
| 30 | Ga0123357_10219888 | 3300009784 | Bacteria | 2110 |
| 31 | Ga0123355_10869862 | 3300009826 | Bacteria | 987 |
| 32 | Ga0123356_10182139 | 3300010049 | Bacteria | 2123 |
| 33 | Ga0123356_11555381 | 3300010049 | Bacteria | 817 |
| 34 | Ga0123356_11941845 | 3300010049 | Bacteria | 733 |
| 35 | Ga0123356_13155497 | 3300010049 | Bacteria | 574 |
| 36 | Ga0123353_10458310 | 3300010167 | Bacteria | 1874 |
| 37 | Ga0466731_081847 | 3300042622 | Bacteria | 13431 |
| 38 | Ga0466731_410584 | 3300042622 | Bacteria | 1328 |
| 39 | Ga0466700_107346 | 3300042600 | Bacteria | 1151 |
| 40 | Ga0264413_115222 | 3300024493 | Bacteria | 1228 |
| 41 | JGI24698J34947_10035986 | 3300002449 | Bacteria | 2580 |
| 42 | JGI24698J34947_10084929 | 3300002449 | Bacteria | 1472 |
| 43 | JGI24698J34947_10142561 | 3300002449 | Bacteria | 1007 |
| 44 | JGI24695J34938_10000054 | 3300002450 | Bacteria | 90526 |
| 45 | JGI24695J34938_10003645 | 3300002450 | Bacteria | 10573 |
| 46 | JGI24695J34938_10048796 | 3300002450 | Bacteria | 1864 |
| 47 | JGI24695J34938_10154620 | 3300002450 | Bacteria | 941 |
| 48 | Ga0123357_10344646 | 3300009784 | Bacteria | 1435 |
| 49 | Ga0123356_10000102 | 3300010049 | Bacteria | 90045 |
| 50 | Ga0123356_10982846 | 3300010049 | Bacteria | 1014 |
| 51 | Ga0123356_11726490 | 3300010049 | Bacteria | 777 |
| 52 | Ga0466725_152679 | 3300042654 | Bacteria | 13122 |
| 53 | Ga0466732_174184 | 3300042656 | Bacteria | 1293 |
| 54 | Ga0466700_488752 | 3300042600 | Bacteria | 2112 |
| 55 | Ga0466698_220659 | 3300042610 | Bacteria | 1289 |
| 56 | Ga0466712_027787 | 3300042614 | Bacteria | 10412 |
| 57 | Ga0466712_178535 | 3300042614 | Unclassified | 5335 |
| 58 | Ga0466718_151509 | 3300042617 | Bacteria | 2001 |
| 59 | Ga0415639_048544 | 3300038395 | Bacteria | 1762 |
| 60 | JGI24698J34947_10003190 | 3300002449 | Bacteria | 8884 |
| 61 | JGI24698J34947_10009117 | 3300002449 | Unclassified | 5445 |
| 62 | JGI24698J34947_10023620 | 3300002449 | Bacteria | 3288 |
| 63 | JGI24698J34947_10092183 | 3300002449 | Unclassified | 1386 |
| 64 | JGI24698J34947_10117261 | 3300002449 | Bacteria | 1163 |
| 65 | JGI24698J34947_10139158 | 3300002449 | Bacteria | 1025 |
| 66 | JGI24695J34938_10032047 | 3300002450 | Bacteria | 2432 |
| 67 | JGI24695J34938_10348831 | 3300002450 | Unclassified | 650 |
| 68 | Ga0072941_1006027 | 3300005201 | Bacteria | 26639 |
| 69 | Ga0072941_1011804 | 3300005201 | Bacteria | 1506 |
| 70 | Ga0072941_1012034 | 3300005201 | Bacteria | 9815 |
| 71 | Ga0123356_10027516 | 3300010049 | Bacteria | 5327 |
| 72 | Ga0123356_11241161 | 3300010049 | Bacteria | 910 |
| 73 | Ga0123353_10336104 | 3300010167 | Bacteria | 2284 |
| 74 | Ga0123353_11365713 | 3300010167 | Bacteria | 914 |
| 75 | Ga0466720_222147 | 3300042607 | Bacteria | 2065 |
| 76 | Ga0466712_005495 | 3300042614 | Bacteria | 8289 |
| 77 | Ga0466712_050541 | 3300042614 | Bacteria | 1020 |
| 78 | Ga0415639_001133 | 3300038395 | Bacteria | 22260 |
| 79 | Ga0466693_444491 | 3300042592 | Unclassified | 3476 |
| 80 | FAAS_10311140 | 3300001880 | Bacteria | 532 |
| 81 | JGI24695J34938_10023571 | 3300002450 | Bacteria | 2966 |
| 82 | JGI24695J34938_10069317 | 3300002450 | Bacteria | 1479 |
| 83 | JGI24696J40584_12923474 | 3300002834 | Bacteria | 1376 |
| 84 | Ga0072941_1009944 | 3300005201 | Bacteria | 3600 |
| 85 | Ga0072941_1025647 | 3300005201 | Bacteria | 13070 |
| 86 | Ga0123355_10069405 | 3300009826 | Unclassified | 5665 |
| 87 | Ga0123355_10864700 | 3300009826 | Bacteria | 991 |
| 88 | Ga0123356_11048258 | 3300010049 | Bacteria | 985 |
| 89 | Ga0123356_11124279 | 3300010049 | Bacteria | 953 |
| 90 | Ga0123356_12387504 | 3300010049 | Bacteria | 662 |
| 91 | Ga0123353_10539504 | 3300010167 | Bacteria | 1686 |
| 92 | Ga0123353_11375822 | 3300010167 | Unclassified | 910 |
| 93 | Ga0123353_11839348 | 3300010167 | Bacteria | 750 |
| 94 | Ga0123354_10485397 | 3300010882 | Bacteria | 974 |
| 95 | Ga0123354_10524737 | 3300010882 | Bacteria | 908 |
| 96 | Ga0466700_462937 | 3300042600 | Bacteria | 1134 |
| 97 | Ga0466720_059338 | 3300042607 | Unclassified | 9641 |
| 98 | Ga0466720_075712 | 3300042607 | Bacteria | 8794 |
| 99 | Ga0466720_098403 | 3300042607 | Bacteria | 2098 |
| 100 | Ga0466712_036259 | 3300042614 | Bacteria | 23962 |
| 101 | Ga0466712_040936 | 3300042614 | Bacteria | 1001 |
| 102 | Ga0466712_124670 | 3300042614 | Bacteria | 8688 |
| 103 | Ga0466712_154521 | 3300042614 | Bacteria | 2872 |
| 104 | Ga0466712_251960 | 3300042614 | Unclassified | 3223 |
| 105 | Ga0466718_012232 | 3300042617 | Bacteria | 1099 |
| 106 | Nasutiter_Contig44323 | 2030936001 | Unclassified | 636 |
| 107 | JGI24698J34947_10003811 | 3300002449 | Bacteria | 8214 |
| 108 | JGI24695J34938_10050934 | 3300002450 | Bacteria | 1814 |
| 109 | JGI24695J34938_10179844 | 3300002450 | Unclassified | 875 |
| 110 | JGI24702J35022_10090628 | 3300002462 | Bacteria | 1664 |
| 111 | JGI24703J35330_11571829 | 3300002501 | Unclassified | 1283 |
| 112 | Ga0072940_1057025 | 3300005200 | Bacteria | 785 |
| 113 | Ga0123355_10079270 | 3300009826 | Bacteria | 5245 |
| 114 | Ga0123355_10086782 | 3300009826 | Bacteria | 4976 |
| 115 | Ga0466720_049066 | 3300042607 | Bacteria | 14539 |
| 116 | Ga0466712_043460 | 3300042614 | Unclassified | 3590 |
| 117 | Ga0466712_055222 | 3300042614 | Bacteria | 9215 |
| 118 | Ga0466712_059528 | 3300042614 | Bacteria | 6647 |
| 119 | Ga0415639_159145 | 3300038395 | Bacteria | 2742 |
| 120 | Ga0466694_397173 | 3300042594 | Bacteria | 1334 |
| 121 | Ga0466695_385003 | 3300042595 | Bacteria | 3685 |
| 122 | JGI24698J34947_10024715 | 3300002449 | Bacteria | 3205 |
| 123 | JGI24698J34947_10044596 | 3300002449 | Unclassified | 2269 |
| 124 | JGI24695J34938_10067333 | 3300002450 | Bacteria | 1507 |
| 125 | JGI24702J35022_10100963 | 3300002462 | Unclassified | 1579 |
| 126 | JGI24699J35502_11125031 | 3300002509 | Unclassified | 3739 |
| 127 | Ga0072941_1148822 | 3300005201 | Bacteria | 605 |
| 128 | Ga0123356_10000281 | 3300010049 | Bacteria | 58777 |
| 129 | Ga0123356_10002470 | 3300010049 | Bacteria | 19739 |
| 130 | Ga0123356_10036329 | 3300010049 | Bacteria | 4601 |
| 131 | Ga0123356_10251787 | 3300010049 | Bacteria | 1844 |
| 132 | Ga0123356_11751456 | 3300010049 | Bacteria | 771 |
| 133 | Ga0123356_12009405 | 3300010049 | Unclassified | 721 |
| 134 | Ga0123353_10349958 | 3300010167 | Bacteria | 2227 |
| 135 | Ga0123353_11945447 | 3300010167 | Bacteria | 723 |
| 136 | Ga0123354_10023635 | 3300010882 | Bacteria | 9693 |
| 137 | Ga0466702_037516 | 3300042635 | Bacteria | 1355 |
| 138 | Ga0466702_331748 | 3300042635 | Bacteria | 1058 |
| 139 | Ga0466700_052658 | 3300042600 | Bacteria | 1872 |
| 140 | Ga0466712_298219 | 3300042614 | Bacteria | 1349 |
| 141 | Ga0466718_000867 | 3300042617 | Bacteria | 1343 |
| 142 | Ga0466718_133258 | 3300042617 | Bacteria | 1430 |
| 143 | Ga0264413_119229 | 3300024493 | Bacteria | 4028 |
| 144 | Ga0466656_232464 | 3300042550 | Bacteria | 1328 |
| 145 | Ga0466695_234181 | 3300042595 | Bacteria | 1014 |
| 146 | AustNasuHG_c1035277 | 3300000089 | Unclassified | 1321 |
| 147 | JGI24698J34947_10000804 | 3300002449 | Bacteria | 15599 |
| 148 | JGI24698J34947_10036582 | 3300002449 | Bacteria | 2555 |
| 149 | JGI24698J34947_10175339 | 3300002449 | Bacteria | 863 |
| 150 | JGI24695J34938_10002005 | 3300002450 | Bacteria | 16160 |
| 151 | JGI24695J34938_10010945 | 3300002450 | Bacteria | 4925 |
| 152 | JGI24695J34938_10083325 | 3300002450 | Bacteria | 1319 |
| 153 | JGI24695J34938_10413813 | 3300002450 | Bacteria | 603 |
| 154 | Ga0072940_1072501 | 3300005200 | Bacteria | 4151 |
| 155 | Ga0123355_10069099 | 3300009826 | Bacteria | 5679 |
| 156 | Ga0123355_10735238 | 3300009826 | Bacteria | 1121 |
| 157 | Ga0123356_12318541 | 3300010049 | Bacteria | 671 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.