Protein Family IF03292
Metagenome
Isolate
124
Members
48
Samples
114
Scaffolds
132.6
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10428069|Ga0123353_104280694
- Length
- 151 aa
- Sequence
- MLWRVKPRRLKPYFKGGLIMFYEYQLSTPREGFYDITRQVREAISKSGIASGIAIVYCPHTTAGITINENADPDVIHDLLIGLGKAFPDRSEFRHSEGNSAAHLKASVIGSSVTVIIEGGNPVLGTWQGIYFCEFDAPRTRRFFVKLIGA*
Sample Types
Isolate
8.1%
Metagenome
91.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
59.6%
Unclassified
23.4%
Kalotermitidae
8.5%
Termopsidae
4.3%
Hodotermitidae
2.1%
Rhinotermitidae
2.1%
Taxonomy
Archaea
3
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820018428 | Unclassified Spirochaetes Nt197P3bin33 | Isolate | Unclassified |
| 2 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 3 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 19 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 22 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 23 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 2820946191 | Unclassified Acidobacteria Nt197P3bin31 | Isolate | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 31 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 2820013017 | Unclassified Spirochaetes Th196P3bin152 | Isolate | Unclassified |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 2740892547 | Fibrobacteria bacterium GUT77 MC_77 | Isolate | Unclassified |
| 39 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 40 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 41 | 2820615445 | Unclassified Firmicutes Emb289P1bin132 | Isolate | Unclassified |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 46 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24695J34938_10373706 | 3300002450 | Bacteria | 631 |
| 2 | Ga0466713_130456 | 3300042602 | Bacteria | 105855 |
| 3 | Ga0466717_275945 | 3300042604 | Bacteria | 1415 |
| 4 | Ga0415639_016703 | 3300038395 | Bacteria | 7449 |
| 5 | Ga0466695_066490 | 3300042595 | Bacteria | 1071 |
| 6 | Ga0123356_10172733 | 3300010049 | Bacteria | 2174 |
| 7 | Ga0123356_10660236 | 3300010049 | Bacteria | 1213 |
| 8 | Ga0123353_10399629 | 3300010167 | Bacteria | 2046 |
| 9 | Ga0466705_082860 | 3300042612 | Unclassified | 2723 |
| 10 | Ga0466732_435467 | 3300042656 | Bacteria | 1037 |
| 11 | Ga0466713_063968 | 3300042602 | Bacteria | 85504 |
| 12 | Ga0466714_161767 | 3300042603 | Bacteria | 1281 |
| 13 | Ga0466712_238376 | 3300042614 | Bacteria | 1148 |
| 14 | Ga0466712_280844 | 3300042614 | Bacteria | 1020 |
| 15 | Ga0466711_450699 | 3300042615 | Bacteria | 9282 |
| 16 | Ga0466731_137089 | 3300042622 | Bacteria | 1146 |
| 17 | Ga0466735_204961 | 3300042624 | Bacteria | 3024 |
| 18 | Ga0123357_10334816 | 3300009784 | Bacteria | 1473 |
| 19 | Ga0123355_10214024 | 3300009826 | Bacteria | 2786 |
| 20 | Ga0123355_10243810 | 3300009826 | Bacteria | 2541 |
| 21 | Ga0123356_10012516 | 3300010049 | Bacteria | 8227 |
| 22 | Ga0123356_10549904 | 3300010049 | Bacteria | 1315 |
| 23 | Ga0123356_12089307 | 3300010049 | Bacteria | 707 |
| 24 | Ga0123353_10302231 | 3300010167 | Bacteria | 2441 |
| 25 | Ga0123353_10428069 | 3300010167 | Unclassified | 1958 |
| 26 | Ga0123353_11323397 | 3300010167 | Bacteria | 933 |
| 27 | Ga0466733_008581 | 3300042659 | Bacteria | 6954 |
| 28 | JGI24702J35022_10278281 | 3300002462 | Bacteria | 981 |
| 29 | Ga0072940_1076455 | 3300005200 | Bacteria | 10597 |
| 30 | Ga0072940_1171556 | 3300005200 | Bacteria | 4098 |
| 31 | Ga0466706_123279 | 3300042599 | Bacteria | 1626 |
| 32 | Ga0466706_168984 | 3300042599 | Bacteria | 4856 |
| 33 | Ga0466714_074094 | 3300042603 | Bacteria | 1245 |
| 34 | Ga0466704_056822 | 3300042643 | Bacteria | 2104 |
| 35 | Ga0466727_124654 | 3300042655 | Bacteria | 1823 |
| 36 | Ga0123357_10397202 | 3300009784 | Bacteria | 1259 |
| 37 | Ga0123356_10023790 | 3300010049 | Bacteria | 5764 |
| 38 | Ga0123353_10050958 | 3300010167 | Unclassified | 6605 |
| 39 | Ga0123353_10152745 | 3300010167 | Archaea | 3684 |
| 40 | Ga0123353_10265072 | 3300010167 | Bacteria | 2651 |
| 41 | Ga0123353_11890800 | 3300010167 | Bacteria | 737 |
| 42 | JGI24695J34938_10000403 | 3300002450 | Bacteria | 42148 |
| 43 | JGI24695J34938_10141998 | 3300002450 | Bacteria | 981 |
| 44 | JGI24702J35022_10199921 | 3300002462 | Bacteria | 1143 |
| 45 | Ga0466706_086901 | 3300042599 | Bacteria | 5031 |
| 46 | Ga0466706_211904 | 3300042599 | Bacteria | 4934 |
| 47 | Ga0466720_182466 | 3300042607 | Bacteria | 4994 |
| 48 | Ga0466721_364283 | 3300042608 | Bacteria | 1075 |
| 49 | Ga0466722_063982 | 3300042609 | Bacteria | 25229 |
| 50 | Ga0466698_107811 | 3300042610 | Unclassified | 1099 |
| 51 | Ga0466705_389838 | 3300042612 | Bacteria | 10572 |
| 52 | Ga0466710_078240 | 3300042613 | Archaea | 2424 |
| 53 | Ga0264413_130007 | 3300024493 | Bacteria | 12083 |
| 54 | Ga0466699_405433 | 3300042597 | Bacteria | 1277 |
| 55 | Ga0123355_11229312 | 3300009826 | Bacteria | 761 |
| 56 | Ga0123356_10540814 | 3300010049 | Bacteria | 1325 |
| 57 | Ga0123356_10752323 | 3300010049 | Bacteria | 1145 |
| 58 | Ga0123356_11332858 | 3300010049 | Unclassified | 880 |
| 59 | Ga0123353_10003833 | 3300010167 | Bacteria | 19182 |
| 60 | Ga0123353_10492780 | 3300010167 | Bacteria | 1788 |
| 61 | Ga0123354_10523080 | 3300010882 | Bacteria | 910 |
| 62 | Ga0466705_198299 | 3300042612 | Bacteria | 8603 |
| 63 | Ga0466705_204366 | 3300042612 | Bacteria | 2349 |
| 64 | JGI24695J34938_10098020 | 3300002450 | Bacteria | 1199 |
| 65 | JGI24705J35276_12228288 | 3300002504 | Bacteria | 3159 |
| 66 | Ga0466701_088215 | 3300042598 | Bacteria | 1270 |
| 67 | Ga0466711_166087 | 3300042615 | Bacteria | 7298 |
| 68 | Ga0466718_004847 | 3300042617 | Bacteria | 3076 |
| 69 | Ga0123355_10044436 | 3300009826 | Bacteria | 7232 |
| 70 | Ga0123355_10405084 | 3300009826 | Bacteria | 1756 |
| 71 | Ga0123356_10343618 | 3300010049 | Bacteria | 1614 |
| 72 | Ga0123356_11335553 | 3300010049 | Bacteria | 879 |
| 73 | Ga0123353_10996804 | 3300010167 | Bacteria | 1126 |
| 74 | Ga0466705_096345 | 3300042612 | Unclassified | 2702 |
| 75 | Ga0466721_205699 | 3300042608 | Bacteria | 1346 |
| 76 | Ga0466704_199147 | 3300042643 | Bacteria | 5690 |
| 77 | Ga0415639_065676 | 3300038395 | Bacteria | 1111 |
| 78 | Ga0123355_10000349 | 3300009826 | Bacteria | 59735 |
| 79 | Ga0123353_10001578 | 3300010167 | Bacteria | 28002 |
| 80 | Ga0123353_10544045 | 3300010167 | Bacteria | 1677 |
| 81 | Ga0123353_11367346 | 3300010167 | Bacteria | 913 |
| 82 | Ga0123354_10131708 | 3300010882 | Bacteria | 3154 |
| 83 | JGI24695J34938_10145152 | 3300002450 | Bacteria | 971 |
| 84 | Ga0466706_168541 | 3300042599 | Bacteria | 37081 |
| 85 | Ga0415639_003500 | 3300038395 | Bacteria | 6941 |
| 86 | Ga0415639_005596 | 3300038395 | Unclassified | 39897 |
| 87 | Ga0415639_135544 | 3300038395 | Bacteria | 1184 |
| 88 | Ga0123357_10814864 | 3300009784 | Bacteria | 627 |
| 89 | Ga0123355_10027585 | 3300009826 | Bacteria | 9171 |
| 90 | Ga0123355_10251500 | 3300009826 | Bacteria | 2487 |
| 91 | Ga0123356_10010959 | 3300010049 | Bacteria | 8855 |
| 92 | Ga0123356_10158293 | 3300010049 | Bacteria | 2258 |
| 93 | Ga0123353_10076212 | 3300010167 | Bacteria | 5389 |
| 94 | Ga0123353_11163574 | 3300010167 | Bacteria | 1016 |
| 95 | Ga0123353_11556706 | 3300010167 | Bacteria | 838 |
| 96 | Ga0123354_10319505 | 3300010882 | Archaea | 1435 |
| 97 | Ga0466733_017974 | 3300042659 | Bacteria | 1735 |
| 98 | JGI24702J35022_10195527 | 3300002462 | Bacteria | 1155 |
| 99 | JGI24703J35330_11738188 | 3300002501 | Bacteria | 3177 |
| 100 | Ga0466706_242736 | 3300042599 | Bacteria | 24205 |
| 101 | Ga0466717_197412 | 3300042604 | Unclassified | 1948 |
| 102 | Ga0466698_379840 | 3300042610 | Bacteria | 1031 |
| 103 | Ga0466728_164503 | 3300042620 | Bacteria | 8083 |
| 104 | Ga0466734_034672 | 3300042623 | Bacteria | 1006 |
| 105 | Ga0466702_024257 | 3300042635 | Bacteria | 2450 |
| 106 | Ga0264413_144127 | 3300024493 | Bacteria | 2312 |
| 107 | Ga0415639_052159 | 3300038395 | Bacteria | 2750 |
| 108 | Ga0466693_015606 | 3300042592 | Bacteria | 1075 |
| 109 | Ga0466699_126125 | 3300042597 | Bacteria | 1064 |
| 110 | Ga0123355_10287741 | 3300009826 | Unclassified | 2260 |
| 111 | Ga0123356_11365674 | 3300010049 | Bacteria | 870 |
| 112 | Ga0123356_13070701 | 3300010049 | Bacteria | 582 |
| 113 | Ga0123353_10120090 | 3300010167 | Bacteria | 4226 |
| 114 | Ga0123353_10586449 | 3300010167 | Bacteria | 1598 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01894 | UPF0047 | Uncharacterised protein family UPF0047 | 35 | 146 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.