Protein Family IF03268

Metagenome Isolate
103 Members
39 Samples
102 Scaffolds
405.11 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10370329|Ga0123353_103703291
Length
453 aa
Sequence
VENQDILIVFSSVNSHLKIHRGRGGGILYGKKKAVELSPGKILREGEGFMPDKTAKKHKHLTLDDREEIQGCLNHGMTFKAIGQRIGKDQTTVSKEVKRHIVSQPIEHQAFDSQGNPLPPEPCPRHLKTPFCCNPCEKKHRRCGFQKRFYHAKPAQKAYESLLVDCREGVPLKRESFYRMDAIVAEQMKKGQHLYHISQTQNLGVATSSVYRYLHKGYLSAGKMDFPRVVKFKPRQPRQQEYIPKSAKLGRTYDDFRAHVEENDLKHWVEMDTVIGRIGGKVILTLDFTFCNFQVGLLMDNKTSLEAAHKIRKLKNTMTLAGLRFDELLPVILTDNGGEFANVDAFERDAAGQKESLLFFCDPYQASQKPHCEKNHTMFRDIVPSGTAFDDYSQDTVNLIFSHVNNVKRRSLGGKSPFEVFVFLFGRDAAAAFGIRHIPPADVIQSPKLLRK*

📊 Sample Types

Isolate 1.0%
Metagenome 99.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 59.0%
Kalotermitidae 20.5%
Termopsidae 7.7%
Unclassified 5.1%
Rhinotermitidae 5.1%
Passalidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 97
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820441105 Unclassified Firmicutes Lab288P3bin202 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
13 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
19 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
20 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
21 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
24 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
28 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
29 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
30 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
31 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
34 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
35 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
37 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
38 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_154772 3300042612 Bacteria 1929
2 Ga0466729_244055 3300042621 Bacteria 2053
3 Ga0466731_012592 3300042622 Bacteria 2093
4 Ga0466710_178642 3300042613 Bacteria 1769
5 Ga0466711_372181 3300042615 Bacteria 1535
6 Ga0415639_033959 3300038395 Bacteria 1613
7 Ga0415639_067940 3300038395 Bacteria 1598
8 Ga0466657_296128 3300042582 Bacteria 2209
9 Ga0466700_115520 3300042600 Bacteria 2009
10 Ga0466700_439905 3300042600 Bacteria 2847
11 Ga0466714_078097 3300042603 Bacteria 2212
12 Ga0466722_170873 3300042609 Bacteria 1953
13 Ga0466698_244956 3300042610 Bacteria 1856
14 Ga0123355_10408351 3300009826 Unclassified 1745
15 Ga0123356_10185745 3300010049 Bacteria 2105
16 Ga0123353_10370329 3300010167 Bacteria 2148
17 Ga0123353_10581742 3300010167 Bacteria 1606
18 JGI24705J35276_12204435 3300002504 Unclassified 1676
19 Ga0072940_1054943 3300005200 Bacteria 1640
20 Ga0466733_105145 3300042659 Bacteria 1828
21 Ga0466734_132301 3300042623 Unclassified 2390
22 Ga0466724_36729 3300042649 Unclassified 1811
23 Ga0466714_003709 3300042603 Bacteria 1939
24 Ga0466714_143852 3300042603 Bacteria 2722
25 Ga0466714_168172 3300042603 Bacteria 1662
26 Ga0466698_147353 3300042610 Bacteria 1597
27 Ga0123353_10435354 3300010167 Bacteria 1937
28 Ga0123353_10490473 3300010167 Bacteria 1794
29 Ga0466733_035587 3300042659 Bacteria 1690
30 Ga0466729_244763 3300042621 Bacteria 1700
31 Ga0466731_419325 3300042622 Bacteria 1877
32 Ga0466710_006824 3300042613 Bacteria 1518
33 Ga0466710_046637 3300042613 Bacteria 1789
34 Ga0466695_378185 3300042595 Bacteria 1768
35 Ga0466699_050086 3300042597 Bacteria 2672
36 Ga0466707_105383 3300042601 Bacteria 1710
37 Ga0466716_283454 3300042605 Bacteria 2229
38 Ga0123357_10234789 3300009784 Bacteria 2000
39 Ga0123357_10256489 3300009784 Bacteria 1858
40 Ga0123356_10278843 3300010049 Bacteria 1765
41 Ga0123356_10357333 3300010049 Bacteria 1587
42 JGI24702J35022_10022249 3300002462 Bacteria 3433
43 Ga0466729_244479 3300042621 Bacteria 1738
44 Ga0466703_071922 3300042636 Bacteria 2062
45 Ga0466704_322433 3300042643 Bacteria 6919
46 Ga0466726_491991 3300042619 Bacteria 1584
47 Ga0466657_075632 3300042582 Bacteria 1854
48 Ga0466699_256314 3300042597 Bacteria 1850
49 Ga0466707_004572 3300042601 Bacteria 5870
50 Ga0466714_055510 3300042603 Bacteria 2767
51 Ga0123356_10188429 3300010049 Bacteria 2091
52 Ga0123356_10209553 3300010049 Bacteria 1996
53 Ga0123356_10211515 3300010049 Bacteria 1988
54 Ga0123356_10257956 3300010049 Bacteria 1825
55 Ga0123356_10418918 3300010049 Bacteria 1481
56 Ga0123353_10414118 3300010167 Bacteria 2000
57 Ga0123353_10429971 3300010167 Bacteria 1953
58 Ga0123353_10537420 3300010167 Bacteria 1690
59 Ga0466731_062633 3300042622 Bacteria 2325
60 Ga0466731_203563 3300042622 Bacteria 1857
61 Ga0466734_173266 3300042623 Bacteria 1742
62 Ga0466724_27561 3300042649 Bacteria 1594
63 Ga0415639_068638 3300038395 Bacteria 2029
64 Ga0123357_10127898 3300009784 Bacteria 3175
65 Ga0123357_10268382 3300009784 Bacteria 1788
66 Ga0123353_10026438 3300010167 Bacteria 8866
67 Ga0123353_10457728 3300010167 Bacteria 1876
68 Ga0466727_303292 3300042655 Bacteria 1844
69 Ga0466699_081852 3300042597 Bacteria 1990
70 Ga0466714_049001 3300042603 Bacteria 1461
71 Ga0466721_154011 3300042608 Bacteria 1824
72 Ga0123356_10316633 3300010049 Bacteria 1672
73 Ga0123353_10291469 3300010167 Bacteria 2498
74 Ga0123353_10298239 3300010167 Bacteria 2462
75 Ga0123353_10310915 3300010167 Bacteria 2398
76 Ga0123353_10397396 3300010167 Bacteria 2053
77 Ga0123353_10478477 3300010167 Bacteria 1823
78 Ga0123353_10517191 3300010167 Bacteria 1733
79 Ga0123354_10175638 3300010882 Bacteria 2470
80 Ga0466697_126472 3300042611 Unclassified 2706
81 Ga0466705_220662 3300042612 Bacteria 2332
82 Ga0466715_221216 3300042616 Bacteria 10194
83 Ga0466700_472858 3300042600 Bacteria 2928
84 Ga0466714_134106 3300042603 Bacteria 3579
85 Ga0466721_377261 3300042608 Bacteria 1870
86 Ga0123357_10172783 3300009784 Unclassified 2550
87 Ga0123353_10370908 3300010167 Bacteria 2146
88 Ga0123353_10388154 3300010167 Bacteria 2085
89 Ga0123353_10464484 3300010167 Bacteria 1858
90 Ga0123353_10589050 3300010167 Bacteria 1593
91 IMNBL1DRAFT_c0039941 3300000062 Bacteria 1594
92 Ga0466697_175698 3300042611 Bacteria 1574
93 Ga0466735_044780 3300042624 Bacteria 2277
94 Ga0466724_30499 3300042649 Bacteria 2570
95 Ga0466718_079853 3300042617 Bacteria 1590
96 Ga0466728_428181 3300042620 Bacteria 1969
97 Ga0466696_449941 3300042596 Bacteria 2386
98 Ga0466707_267058 3300042601 Bacteria 4821
99 Ga0466707_341262 3300042601 Bacteria 1705
100 Ga0466707_382038 3300042601 Bacteria 1998
101 Ga0123356_10085164 3300010049 Bacteria 2997
102 Ga0123353_10529767 3300010167 Bacteria 1706

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_10418918 Ga0123356_104189182 362
2 3300042612 Ga0466705_220662 Ga0466705_220662_790_1902 370
3 3300000062 IMNBL1DRAFT_c0039941 IMNBL1DRAFT_00399411 375
4 3300042601 Ga0466707_004572 Ga0466707_004572_4311_5441 376
5 3300042620 Ga0466728_428181 Ga0466728_428181_329_1459 376
6 3300010049 Ga0123356_10185745 Ga0123356_101857452 378
7 3300042601 Ga0466707_105383 Ga0466707_105383_31_1167 378
8 3300042603 Ga0466714_049001 Ga0466714_049001_110_1246 378
9 3300009826 Ga0123355_10408351 Ga0123355_104083511 380
10 3300038395 Ga0415639_068638 Ga0415639_068638_664_1806 380
11 3300042649 Ga0466724_36729 Ga0466724_36729_227_1447 380
12 3300009784 Ga0123357_10234789 Ga0123357_102347892 382
13 3300042611 Ga0466697_175698 Ga0466697_175698_332_1549 385
14 3300009784 Ga0123357_10172783 Ga0123357_101727832 387
15 3300002504 JGI24705J35276_12204435 JGI24705J35276_122044352 389
16 3300042613 Ga0466710_178642 Ga0466710_178642_379_1551 390
17 3300042622 Ga0466731_203563 Ga0466731_203563_389_1600 391
18 3300010167 Ga0123353_10397396 Ga0123353_103973961 393
19 3300010167 Ga0123353_10464484 Ga0123353_104644841 393
20 3300042601 Ga0466707_341262 Ga0466707_341262_75_1301 394
21 3300042649 Ga0466724_30499 Ga0466724_30499_785_1972 395
22 3300042615 Ga0466711_372181 Ga0466711_372181_110_1300 396
23 3300010167 Ga0123353_10370908 Ga0123353_103709082 397
24 3300042636 Ga0466703_071922 Ga0466703_071922_473_1666 397
25 3300042601 Ga0466707_267058 Ga0466707_267058_154_1353 399
26 3300042603 Ga0466714_003709 Ga0466714_003709_398_1597 399
27 3300042603 Ga0466714_055510 Ga0466714_055510_969_2207 399
28 iso_pr_bacteria 2820441105 2820442391 399
29 3300010167 Ga0123353_10291469 Ga0123353_102914692 400
30 3300010167 Ga0123353_10435354 Ga0123353_104353541 401
31 3300042605 Ga0466716_283454 Ga0466716_283454_746_1951 401
32 3300042613 Ga0466710_006824 Ga0466710_006824_260_1465 401
33 3300009784 Ga0123357_10256489 Ga0123357_102564892 402
34 3300010167 Ga0123353_10581742 Ga0123353_105817421 402
35 3300042608 Ga0466721_154011 Ga0466721_154011_272_1480 402
36 3300042613 Ga0466710_046637 Ga0466710_046637_195_1403 402
37 3300042617 Ga0466718_079853 Ga0466718_079853_111_1319 402
38 3300042621 Ga0466729_244479 Ga0466729_244479_111_1319 402
39 3300002462 JGI24702J35022_10022249 JGI24702J35022_100222492 403
40 3300005200 Ga0072940_1054943 Ga0072940_10549431 403
41 3300009784 Ga0123357_10127898 Ga0123357_101278983 403
42 3300010049 Ga0123356_10188429 Ga0123356_101884292 403
43 3300010167 Ga0123353_10490473 Ga0123353_104904731 403
44 3300042582 Ga0466657_296128 Ga0466657_296128_378_1589 403
45 3300042595 Ga0466695_378185 Ga0466695_378185_355_1566 403
46 3300042597 Ga0466699_050086 Ga0466699_050086_891_2102 403
47 3300042597 Ga0466699_081852 Ga0466699_081852_64_1275 403
48 3300042609 Ga0466722_170873 Ga0466722_170873_111_1322 403
49 3300042622 Ga0466731_419325 Ga0466731_419325_457_1668 403
50 3300042624 Ga0466735_044780 Ga0466735_044780_267_1478 403
51 3300010049 Ga0123356_10257956 Ga0123356_102579561 404
52 3300010049 Ga0123356_10357333 Ga0123356_103573331 404
53 3300010167 Ga0123353_10429971 Ga0123353_104299711 404
54 3300010167 Ga0123353_10478477 Ga0123353_104784771 404
55 3300010167 Ga0123353_10589050 Ga0123353_105890501 404
56 3300042616 Ga0466715_221216 Ga0466715_221216_529_1743 404
57 3300038395 Ga0415639_067940 Ga0415639_067940_107_1324 405
58 3300042603 Ga0466714_078097 Ga0466714_078097_489_1706 405
59 3300042612 Ga0466705_154772 Ga0466705_154772_182_1399 405
60 3300042621 Ga0466729_244055 Ga0466729_244055_597_1814 405
61 3300042623 Ga0466734_173266 Ga0466734_173266_228_1445 405
62 3300042655 Ga0466727_303292 Ga0466727_303292_181_1398 405
63 3300009784 Ga0123357_10268382 Ga0123357_102683822 406
64 3300010167 Ga0123353_10537420 Ga0123353_105374201 406
65 3300042596 Ga0466696_449941 Ga0466696_449941_677_1897 406
66 3300042643 Ga0466704_322433 Ga0466704_322433_470_1690 406
67 3300010167 Ga0123353_10529767 Ga0123353_105297671 407
68 3300042600 Ga0466700_115520 Ga0466700_115520_247_1470 407
69 3300042619 Ga0466726_491991 Ga0466726_491991_120_1343 407
70 3300010167 Ga0123353_10298239 Ga0123353_102982392 408
71 3300042600 Ga0466700_472858 Ga0466700_472858_708_1934 408
72 3300042603 Ga0466714_134106 Ga0466714_134106_728_1954 408
73 3300042621 Ga0466729_244763 Ga0466729_244763_224_1450 408
74 3300042610 Ga0466698_244956 Ga0466698_244956_340_1569 409
75 3300042603 Ga0466714_143852 Ga0466714_143852_1195_2433 412
76 3300042603 Ga0466714_168172 Ga0466714_168172_165_1403 412
77 3300042622 Ga0466731_012592 Ga0466731_012592_445_1683 412
78 3300042659 Ga0466733_105145 Ga0466733_105145_347_1585 412
79 3300010049 Ga0123356_10316633 Ga0123356_103166331 413
80 3300010167 Ga0123353_10388154 Ga0123353_103881542 413
81 3300010167 Ga0123353_10517191 Ga0123353_105171911 413
82 3300010049 Ga0123356_10085164 Ga0123356_100851643 414
83 3300010049 Ga0123356_10211515 Ga0123356_102115152 418
84 3300010167 Ga0123353_10457728 Ga0123353_104577282 418
85 3300010049 Ga0123356_10278843 Ga0123356_102788431 420
86 3300010049 Ga0123356_10209553 Ga0123356_102095532 422
87 3300042622 Ga0466731_062633 Ga0466731_062633_648_1916 422
88 3300042610 Ga0466698_147353 Ga0466698_147353_80_1351 423
89 3300042649 Ga0466724_27561 Ga0466724_27561_264_1535 423
90 3300038395 Ga0415639_033959 Ga0415639_033959_223_1497 424
91 3300042659 Ga0466733_035587 Ga0466733_035587_301_1575 424
92 3300042597 Ga0466699_256314 Ga0466699_256314_161_1438 425
93 3300010882 Ga0123354_10175638 Ga0123354_101756382 426
94 3300010167 Ga0123353_10026438 Ga0123353_1002643810 427
95 3300042601 Ga0466707_382038 Ga0466707_382038_386_1684 432
96 3300010167 Ga0123353_10310915 Ga0123353_103109153 433
97 3300042600 Ga0466700_439905 Ga0466700_439905_656_1960 434
98 3300042582 Ga0466657_075632 Ga0466657_075632_426_1733 435
99 3300042611 Ga0466697_126472 Ga0466697_126472_551_1858 435
100 3300042623 Ga0466734_132301 Ga0466734_132301_968_2275 435
101 3300010167 Ga0123353_10414118 Ga0123353_104141182 443
102 3300042608 Ga0466721_377261 Ga0466721_377261_322_1656 444
103 3300010167 Ga0123353_10370329 Ga0123353_103703291 453

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13936 HTH_38 Helix-turn-helix domain 57 100 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.55 0.63 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.