Protein Family IF03243
Metagenome
Isolate
120
Members
40
Samples
116
Scaffolds
335.68
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10310173|Ga0123353_103101732
- Length
- 325 aa
- Sequence
- MEELGHVHDSQALDKLRVSVLGKKGRMTGLLRGMSSVPPEQRPELGKLINQAAEALERAIYERVRELTAIETGDRLAREEVDVTMPGKPVKLGGIHPVSITASLLTDIFVSMGFEVVEGPEIELDHYNFELLNMPRNHPARDAQDTFYIDENIVLRTHTSPVQARAMLRGKPPIRIVCPGRVYRVDEVDATHTPVFHQMEGLLVDEGIAMSDLKGTLDLFARRLFGEGVTTRFRPAFFPFTEPSAEVDLTCVACKGVGGGGWIEVLGAGMVNPKVLDMCGINSARYSGFAFGMGIDRLTNLKYGITDGRYEFENDLRFLRQFGG*
Sample Types
Isolate
3.3%
Metagenome
96.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.5%
Kalotermitidae
28.2%
Unclassified
15.4%
Rhinotermitidae
7.7%
Termopsidae
7.7%
Hodotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 2 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 9 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 18 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 21 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 22 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 35 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 38 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_084583 | 3300042611 | Bacteria | 2867 |
| 2 | Ga0466703_042866 | 3300042636 | Bacteria | 2570 |
| 3 | Ga0466704_054820 | 3300042643 | Bacteria | 55164 |
| 4 | Ga0466704_488964 | 3300042643 | Bacteria | 51888 |
| 5 | Ga0466708_269094 | 3300042652 | Bacteria | 15950 |
| 6 | Ga0466696_092510 | 3300042596 | Bacteria | 3153 |
| 7 | Ga0466696_107606 | 3300042596 | Unclassified | 1970 |
| 8 | Ga0466728_046316 | 3300042620 | Bacteria | 2021 |
| 9 | Ga0123356_10304151 | 3300010049 | Unclassified | 1701 |
| 10 | Ga0123353_10167355 | 3300010167 | Bacteria | 3493 |
| 11 | Ga0123353_10351519 | 3300010167 | Bacteria | 2220 |
| 12 | Ga0123353_10450628 | 3300010167 | Bacteria | 1894 |
| 13 | Ga0123353_10623624 | 3300010167 | Bacteria | 1534 |
| 14 | Ga0466707_024234 | 3300042601 | Bacteria | 8167 |
| 15 | Ga0466707_048570 | 3300042601 | Bacteria | 2607 |
| 16 | Ga0466707_054931 | 3300042601 | Bacteria | 9516 |
| 17 | Ga0466702_199452 | 3300042635 | Bacteria | 1716 |
| 18 | Ga0466703_353935 | 3300042636 | Unclassified | 3350 |
| 19 | Ga0466704_543472 | 3300042643 | Bacteria | 8055 |
| 20 | Ga0466727_227477 | 3300042655 | Bacteria | 1923 |
| 21 | Ga0466691_033868 | 3300042593 | Bacteria | 6777 |
| 22 | Ga0072941_1017423 | 3300005201 | Bacteria | 15579 |
| 23 | Ga0466715_362388 | 3300042616 | Bacteria | 17172 |
| 24 | Ga0466718_008181 | 3300042617 | Bacteria | 5921 |
| 25 | Ga0466728_115413 | 3300042620 | Bacteria | 5712 |
| 26 | Ga0466729_081990 | 3300042621 | Bacteria | 13667 |
| 27 | Ga0123353_10006459 | 3300010167 | Bacteria | 15604 |
| 28 | Ga0123353_10379396 | 3300010167 | Bacteria | 2115 |
| 29 | Ga0123353_10853422 | 3300010167 | Bacteria | 1248 |
| 30 | Ga0466707_094241 | 3300042601 | Bacteria | 19773 |
| 31 | Ga0466719_558140 | 3300042606 | Bacteria | 3743 |
| 32 | Ga0466722_178742 | 3300042609 | Bacteria | 4532 |
| 33 | Ga0466704_316609 | 3300042643 | Unclassified | 8398 |
| 34 | Ga0466708_115560 | 3300042652 | Bacteria | 16538 |
| 35 | Ga0466727_236389 | 3300042655 | Bacteria | 18713 |
| 36 | Ga0123355_10004329 | 3300009826 | Bacteria | 20654 |
| 37 | Ga0123356_10229747 | 3300010049 | Bacteria | 1919 |
| 38 | Ga0123356_10732292 | 3300010049 | Bacteria | 1159 |
| 39 | Ga0123353_10000470 | 3300010167 | Bacteria | 50202 |
| 40 | Ga0123353_10208387 | 3300010167 | Bacteria | 3068 |
| 41 | Ga0123353_10310173 | 3300010167 | Bacteria | 2402 |
| 42 | Ga0466706_159917 | 3300042599 | Bacteria | 1620 |
| 43 | Ga0466707_140532 | 3300042601 | Bacteria | 1887 |
| 44 | Ga0466707_368478 | 3300042601 | Bacteria | 14275 |
| 45 | Ga0466719_311125 | 3300042606 | Bacteria | 3190 |
| 46 | Ga0466705_352407 | 3300042612 | Bacteria | 12364 |
| 47 | Ga0466704_391973 | 3300042643 | Bacteria | 1450 |
| 48 | Ga0466715_515018 | 3300042616 | Bacteria | 10090 |
| 49 | Ga0466715_589078 | 3300042616 | Bacteria | 13841 |
| 50 | Ga0123356_10098644 | 3300010049 | Bacteria | 2798 |
| 51 | Ga0123353_10743180 | 3300010167 | Bacteria | 1367 |
| 52 | Ga0466707_060570 | 3300042601 | Bacteria | 1867 |
| 53 | Ga0466713_051871 | 3300042602 | Bacteria | 91128 |
| 54 | Ga0466720_119893 | 3300042607 | Bacteria | 10664 |
| 55 | Ga0466697_001299 | 3300042611 | Bacteria | 1852 |
| 56 | Ga0466705_168405 | 3300042612 | Bacteria | 51359 |
| 57 | Ga0466705_373270 | 3300042612 | Bacteria | 9301 |
| 58 | Ga0466734_145379 | 3300042623 | Bacteria | 2730 |
| 59 | Ga0466703_096109 | 3300042636 | Bacteria | 1253 |
| 60 | Ga0466708_119267 | 3300042652 | Bacteria | 12272 |
| 61 | Ga0466727_012122 | 3300042655 | Bacteria | 31899 |
| 62 | Ga0466692_067765 | 3300042591 | Bacteria | 5457 |
| 63 | Ga0466691_142002 | 3300042593 | Bacteria | 10067 |
| 64 | Ga0466694_065633 | 3300042594 | Bacteria | 7454 |
| 65 | Ga0072940_1036297 | 3300005200 | Bacteria | 18035 |
| 66 | Ga0466726_072525 | 3300042619 | Bacteria | 10313 |
| 67 | Ga0466726_149578 | 3300042619 | Bacteria | 3556 |
| 68 | Ga0123354_10002160 | 3300010882 | Bacteria | 25489 |
| 69 | Ga0466707_156252 | 3300042601 | Bacteria | 8645 |
| 70 | Ga0466722_018474 | 3300042609 | Bacteria | 25068 |
| 71 | Ga0466722_188774 | 3300042609 | Bacteria | 1271 |
| 72 | Ga0466705_363766 | 3300042612 | Bacteria | 2372 |
| 73 | Ga0466704_422848 | 3300042643 | Bacteria | 4031 |
| 74 | Ga0466692_015178 | 3300042591 | Bacteria | 9110 |
| 75 | Ga0466692_065766 | 3300042591 | Bacteria | 15952 |
| 76 | Ga0466695_306807 | 3300042595 | Bacteria | 6354 |
| 77 | Ga0466696_427828 | 3300042596 | Bacteria | 5123 |
| 78 | Ga0466705_497234 | 3300042612 | Bacteria | 14711 |
| 79 | Ga0466715_561496 | 3300042616 | Bacteria | 4517 |
| 80 | Ga0466723_109122 | 3300042618 | Bacteria | 26597 |
| 81 | Ga0123356_10033607 | 3300010049 | Bacteria | 4796 |
| 82 | Ga0123353_10053341 | 3300010167 | Bacteria | 6462 |
| 83 | Ga0123353_10124501 | 3300010167 | Unclassified | 4143 |
| 84 | Ga0466707_176117 | 3300042601 | Bacteria | 14271 |
| 85 | Ga0466719_230210 | 3300042606 | Bacteria | 7871 |
| 86 | Ga0466722_051162 | 3300042609 | Bacteria | 8282 |
| 87 | Ga0466697_228897 | 3300042611 | Bacteria | 6795 |
| 88 | Ga0466703_362029 | 3300042636 | Bacteria | 3354 |
| 89 | Ga0466694_388212 | 3300042594 | Bacteria | 1612 |
| 90 | Ga0466695_211624 | 3300042595 | Bacteria | 9758 |
| 91 | Ga0466696_083062 | 3300042596 | Bacteria | 6404 |
| 92 | JGI24698J34947_10027997 | 3300002449 | Unclassified | 2987 |
| 93 | Ga0466711_069612 | 3300042615 | Bacteria | 26057 |
| 94 | Ga0466711_488842 | 3300042615 | Bacteria | 8191 |
| 95 | Ga0466723_093524 | 3300042618 | Bacteria | 2593 |
| 96 | Ga0466728_444700 | 3300042620 | Bacteria | 11286 |
| 97 | Ga0123356_10011285 | 3300010049 | Bacteria | 8716 |
| 98 | Ga0123356_10013204 | 3300010049 | Bacteria | 7989 |
| 99 | Ga0123353_10047436 | 3300010167 | Bacteria | 6832 |
| 100 | Ga0123353_10265906 | 3300010167 | Bacteria | 2646 |
| 101 | Ga0466707_159669 | 3300042601 | Bacteria | 505639 |
| 102 | Ga0466719_297377 | 3300042606 | Bacteria | 2050 |
| 103 | Ga0466720_069798 | 3300042607 | Bacteria | 16020 |
| 104 | Ga0466705_251955 | 3300042612 | Bacteria | 50238 |
| 105 | Ga0466704_130449 | 3300042643 | Bacteria | 3699 |
| 106 | Ga0466708_219098 | 3300042652 | Bacteria | 13715 |
| 107 | JGI24698J34947_10000161 | 3300002449 | Bacteria | 25689 |
| 108 | Ga0068302_10105768 | 3300005071 | Bacteria | 4767 |
| 109 | Ga0466712_108915 | 3300042614 | Bacteria | 16107 |
| 110 | Ga0466723_216051 | 3300042618 | Bacteria | 2464 |
| 111 | Ga0123355_10006603 | 3300009826 | Bacteria | 17217 |
| 112 | Ga0123356_10729531 | 3300010049 | Bacteria | 1161 |
| 113 | Ga0466700_380018 | 3300042600 | Bacteria | 2165 |
| 114 | Ga0466707_167229 | 3300042601 | Bacteria | 21514 |
| 115 | Ga0466707_262949 | 3300042601 | Bacteria | 2097 |
| 116 | Ga0466713_126619 | 3300042602 | Bacteria | 3662 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.