Protein Family IF03217
Metagenome
Isolate
111
Members
40
Samples
94
Scaffolds
381.18
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10253353|Ga0123353_102533532
- Length
- 364 aa
- Sequence
- MEYRELGKTGKKVGVIGLGGEHLDKKPYEQVKETIDAALEHGVNIIDVFMPGKEVREFIAKALGNRRSEVMIQGHIGATNVNEQYDISRDLPTVKKYFEELLRIFGGYIDFGMMFFIDSEKNYNDVFETGFAGSSHNPVTAMKVINTGLPEMFMFSVNPAFDMLPSDEYALDHLDGNFETSMLKGIDPKRAQLYKLCEAKQIGITVMKSLGVGKLISKEHTPFDKPMTVPQCVHYALTRPAVGCILPGCKTAAEVHDIMKYFETTDTERDYSEIISSKKSDFRGSCVYCSHCQPCPEEIDIAAVMKLLDVARLDKQNIPPVIKSQYQNLKHKGDECIGCGSCEERCPFGVEIIENMSEASSLL*
Sample Types
Isolate
15.3%
Metagenome
84.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
52.6%
Unclassified
39.5%
Passalidae
5.3%
Termopsidae
2.6%
Taxonomy
Archaea
0
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 3 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 4 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 5 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 6 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 7 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 8 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 9 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 10 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 15 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 20 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 25 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 26 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 27 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 28 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 29 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 30 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 31 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 32 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 33 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 34 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 35 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_139962 | 3300042611 | Bacteria | 2582 |
| 2 | Ga0123355_10411837 | 3300009826 | Bacteria | 1735 |
| 3 | Ga0123356_10019582 | 3300010049 | Bacteria | 6414 |
| 4 | Ga0123353_10679886 | 3300010167 | Bacteria | 1450 |
| 5 | 2227158579 | 2225789004 | Bacteria | 8401 |
| 6 | Ga0264413_149030 | 3300024493 | Bacteria | 1477 |
| 7 | Ga0415639_049002 | 3300038395 | Bacteria | 8380 |
| 8 | Ga0123356_10090455 | 3300010049 | Unclassified | 2914 |
| 9 | Ga0123353_10149532 | 3300010167 | Bacteria | 3730 |
| 10 | Ga0123353_10170535 | 3300010167 | Bacteria | 3455 |
| 11 | JGI24702J35022_10000200 | 3300002462 | Bacteria | 32566 |
| 12 | Ga0415639_011173 | 3300038395 | Bacteria | 2820 |
| 13 | Ga0466693_199471 | 3300042592 | Bacteria | 54862 |
| 14 | Ga0466695_018716 | 3300042595 | Bacteria | 1624 |
| 15 | Ga0466734_119922 | 3300042623 | Bacteria | 4189 |
| 16 | Ga0466734_153019 | 3300042623 | Bacteria | 6238 |
| 17 | Ga0123355_10003096 | 3300009826 | Bacteria | 23724 |
| 18 | Ga0123355_10077006 | 3300009826 | Bacteria | 5332 |
| 19 | Ga0123356_10000039 | 3300010049 | Bacteria | 138853 |
| 20 | Ga0123356_10000722 | 3300010049 | Unclassified | 36504 |
| 21 | Ga0123356_10005174 | 3300010049 | Bacteria | 13337 |
| 22 | Ga0123356_10005395 | 3300010049 | Bacteria | 13022 |
| 23 | Ga0123356_10013047 | 3300010049 | Bacteria | 8038 |
| 24 | Ga0123356_10020559 | 3300010049 | Bacteria | 6244 |
| 25 | Ga0123356_10044193 | 3300010049 | Bacteria | 4147 |
| 26 | Ga0123353_10215722 | 3300010167 | Bacteria | 3006 |
| 27 | Ga0123353_10266841 | 3300010167 | Bacteria | 2640 |
| 28 | Ga0123353_10289780 | 3300010167 | Bacteria | 2507 |
| 29 | Ga0123353_10523867 | 3300010167 | Bacteria | 1719 |
| 30 | Ga0123354_10241212 | 3300010882 | Bacteria | 1859 |
| 31 | Ga0072941_1166387 | 3300005201 | Bacteria | 2037 |
| 32 | Ga0466699_008840 | 3300042597 | Unclassified | 2837 |
| 33 | Ga0466727_014635 | 3300042655 | Bacteria | 2427 |
| 34 | Ga0466700_116978 | 3300042600 | Bacteria | 5106 |
| 35 | Ga0466700_452767 | 3300042600 | Bacteria | 1187 |
| 36 | Ga0466720_037962 | 3300042607 | Bacteria | 7195 |
| 37 | Ga0123357_10010964 | 3300009784 | Bacteria | 11575 |
| 38 | Ga0123356_10068725 | 3300010049 | Bacteria | 3320 |
| 39 | Ga0123356_10109029 | 3300010049 | Bacteria | 2671 |
| 40 | Ga0123356_10236350 | 3300010049 | Bacteria | 1895 |
| 41 | Ga0123356_10252775 | 3300010049 | Bacteria | 1841 |
| 42 | Ga0123353_10379161 | 3300010167 | Bacteria | 2116 |
| 43 | Ga0123353_10533309 | 3300010167 | Bacteria | 1699 |
| 44 | Ga0123353_10647378 | 3300010167 | Bacteria | 1497 |
| 45 | Ga0123354_10185582 | 3300010882 | Bacteria | 2354 |
| 46 | JGI24702J35022_10000122 | 3300002462 | Bacteria | 37778 |
| 47 | Ga0466693_093300 | 3300042592 | Bacteria | 1741 |
| 48 | Ga0123356_10004744 | 3300010049 | Bacteria | 14006 |
| 49 | Ga0123356_10080222 | 3300010049 | Bacteria | 3085 |
| 50 | Ga0123356_10185002 | 3300010049 | Bacteria | 2108 |
| 51 | Ga0123356_10187055 | 3300010049 | Bacteria | 2098 |
| 52 | Ga0123353_10187192 | 3300010167 | Bacteria | 3272 |
| 53 | Ga0123353_10230752 | 3300010167 | Bacteria | 2886 |
| 54 | Ga0123353_10252749 | 3300010167 | Bacteria | 2728 |
| 55 | Ga0123353_10253353 | 3300010167 | Bacteria | 2724 |
| 56 | Ga0123353_10647916 | 3300010167 | Bacteria | 1496 |
| 57 | Ga0123354_10078148 | 3300010882 | Bacteria | 4707 |
| 58 | JGI24705J35276_12234786 | 3300002504 | Bacteria | 5843 |
| 59 | Ga0415639_016194 | 3300038395 | Bacteria | 7482 |
| 60 | Ga0415639_019469 | 3300038395 | Bacteria | 1279 |
| 61 | Ga0415639_053356 | 3300038395 | Bacteria | 2045 |
| 62 | Ga0466725_152990 | 3300042654 | Bacteria | 5185 |
| 63 | Ga0466714_150039 | 3300042603 | Bacteria | 3459 |
| 64 | Ga0466720_009658 | 3300042607 | Bacteria | 10989 |
| 65 | Ga0466720_088552 | 3300042607 | Unclassified | 6430 |
| 66 | Ga0123356_10001943 | 3300010049 | Bacteria | 22375 |
| 67 | Ga0123356_10072489 | 3300010049 | Bacteria | 3236 |
| 68 | Ga0123356_10072656 | 3300010049 | Bacteria | 3232 |
| 69 | Ga0123356_10237524 | 3300010049 | Bacteria | 1891 |
| 70 | Ga0123356_10508160 | 3300010049 | Bacteria | 1362 |
| 71 | Ga0123353_10015435 | 3300010167 | Bacteria | 11096 |
| 72 | Ga0123353_10176221 | 3300010167 | Bacteria | 3390 |
| 73 | Ga0123353_10253783 | 3300010167 | Bacteria | 2721 |
| 74 | Ga0123353_10485073 | 3300010167 | Bacteria | 1807 |
| 75 | AustNasuHG_c1011568 | 3300000089 | Bacteria | 3056 |
| 76 | Ga0123355_10004010 | 3300009826 | Bacteria | 21317 |
| 77 | Ga0123355_10425389 | 3300009826 | Bacteria | 1694 |
| 78 | Ga0123356_10017298 | 3300010049 | Bacteria | 6859 |
| 79 | Ga0123356_10020426 | 3300010049 | Bacteria | 6267 |
| 80 | Ga0123356_10061247 | 3300010049 | Bacteria | 3514 |
| 81 | Ga0123356_10156509 | 3300010049 | Bacteria | 2270 |
| 82 | Ga0123353_10060906 | 3300010167 | Bacteria | 6052 |
| 83 | Ga0123353_10420292 | 3300010167 | Bacteria | 1981 |
| 84 | IMNBL1DRAFT_c0000277 | 3300000062 | Bacteria | 45333 |
| 85 | IMNBL1DRAFT_c0011581 | 3300000062 | Unclassified | 4108 |
| 86 | JGI24702J35022_10002914 | 3300002462 | Bacteria | 10353 |
| 87 | Ga0466694_177432 | 3300042594 | Bacteria | 1227 |
| 88 | Ga0466714_122666 | 3300042603 | Bacteria | 1590 |
| 89 | Ga0466697_003557 | 3300042611 | Bacteria | 1415 |
| 90 | Ga0123356_10058835 | 3300010049 | Bacteria | 3584 |
| 91 | Ga0123353_10004516 | 3300010167 | Bacteria | 17931 |
| 92 | Ga0123353_10478329 | 3300010167 | Bacteria | 1823 |
| 93 | Ga0123354_10224278 | 3300010882 | Bacteria | 1986 |
| 94 | IMNBL1DRAFT_c0000791 | 3300000062 | Bacteria | 24938 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.