Protein Family IF03182
Metagenome
Isolate
159
Members
67
Samples
142
Scaffolds
300.47
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10184685|Ga0123353_101846857
- Length
- 347 aa
- Sequence
- MQLGFIGLMLISVILPHGRKFSTFQTETVKPFFYLYLTLFSDIIPSMNQEQYLKPEVIQTIKRLDLRAQFIVKGFMSGLHSSPLHGFSVEFSEHRKYTQGDDPNDIDWLVFAKTEKYYIRKYEAETSMNGYLVVDSSRSMGYTQRQTMTKFDYAICLSAALAYLMIHQQDPVGLFTFNEKVQRSIAPSSKRAQLGTLLSVLSNLRPDGQTNIAGSLKQLAAMLKRQSIVMIFSDLLAENIESIGEIMSGLHTLRHRGHDIIVFHILDEAEVKFPFHGAVELFDPESEERIRGNAEMLKRNYLEALEEYRAGFRRECSRSKIDYVELDTGMQFDKALAEYLTRRIGR*
Sample Types
Isolate
10.7%
Metagenome
89.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.4%
Unclassified
27.3%
Kalotermitidae
21.2%
Rhinotermitidae
4.5%
Termopsidae
4.5%
Passalidae
1.5%
Armadillidiidae
1.5%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
40
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 2820183396 | Unclassified Planctomycetes Lab288P3bin214 | Isolate | Unclassified |
| 23 | 2820201435 | Unclassified Planctomycetes Cu122P5bin25 | Isolate | Unclassified |
| 24 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 2820185449 | Unclassified Planctomycetes Lab288P3bin146 | Isolate | Unclassified |
| 30 | 2820215626 | Unclassified Kiritimatiellaeota Nt197P3bin123 | Isolate | Unclassified |
| 31 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 32 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 36 | 2820180635 | Unclassified Planctomycetes Lab288P3bin24 | Isolate | Unclassified |
| 37 | 2820189034 | Unclassified Planctomycetes Emb289P4bin17 | Isolate | Unclassified |
| 38 | 2820196379 | Unclassified Planctomycetes Emb289P3bin158 | Isolate | Unclassified |
| 39 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 47 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 50 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 51 | 2820193510 | Unclassified Planctomycetes Emb289P3bin83 | Isolate | Unclassified |
| 52 | 2820219087 | Unclassified Ignavibacteria Th196P3bin14 | Isolate | Unclassified |
| 53 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 54 | 2820205024 | Unclassified Planctomycetes Cu122P4bin3 | Isolate | Unclassified |
| 55 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 56 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 57 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 58 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 59 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 60 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 61 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 62 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 63 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 64 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 65 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 66 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 67 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466693_304703 | 3300042592 | Unclassified | 1321 |
| 2 | Ga0466694_083520 | 3300042594 | Bacteria | 1240 |
| 3 | Ga0466695_369763 | 3300042595 | Bacteria | 1123 |
| 4 | Ga0466718_063025 | 3300042617 | Bacteria | 5473 |
| 5 | Ga0123353_10000528 | 3300010167 | Bacteria | 47327 |
| 6 | Ga0123353_10001057 | 3300010167 | Unclassified | 33733 |
| 7 | Ga0123353_10002470 | 3300010167 | Bacteria | 22996 |
| 8 | Ga0123353_10004073 | 3300010167 | Bacteria | 18729 |
| 9 | Ga0123353_10034021 | 3300010167 | Unclassified | 7946 |
| 10 | Ga0123353_10184685 | 3300010167 | Bacteria | 3298 |
| 11 | Ga0123353_10236783 | 3300010167 | Bacteria | 2841 |
| 12 | Ga0123353_10592249 | 3300010167 | Bacteria | 1588 |
| 13 | Ga0072941_1212893 | 3300005201 | Bacteria | 3545 |
| 14 | Ga0466729_246935 | 3300042621 | Bacteria | 1495 |
| 15 | Ga0466731_207164 | 3300042622 | Bacteria | 4322 |
| 16 | Ga0466704_218931 | 3300042643 | Unclassified | 4129 |
| 17 | Ga0466704_257909 | 3300042643 | Bacteria | 2104 |
| 18 | Ga0466693_393304 | 3300042592 | Bacteria | 1615 |
| 19 | Ga0466695_402121 | 3300042595 | Unclassified | 6556 |
| 20 | Ga0466710_140531 | 3300042613 | Bacteria | 1488 |
| 21 | Ga0466715_521773 | 3300042616 | Bacteria | 2151 |
| 22 | Ga0123353_10145407 | 3300010167 | Unclassified | 3791 |
| 23 | JGI24702J35022_10006098 | 3300002462 | Bacteria | 6999 |
| 24 | Ga0466701_031675 | 3300042598 | Bacteria | 3096 |
| 25 | Ga0466714_024764 | 3300042603 | Bacteria | 1612 |
| 26 | Ga0466717_134686 | 3300042604 | Bacteria | 3054 |
| 27 | Ga0466705_003155 | 3300042612 | Bacteria | 3271 |
| 28 | Ga0466731_358898 | 3300042622 | Bacteria | 87251 |
| 29 | Ga0466734_103919 | 3300042623 | Bacteria | 1486 |
| 30 | Ga0466703_138222 | 3300042636 | Bacteria | 19596 |
| 31 | Ga0160467_100009 | 3300012829 | Bacteria | 588364 |
| 32 | Ga0466657_074138 | 3300042582 | Bacteria | 2970 |
| 33 | Ga0466696_016976 | 3300042596 | Bacteria | 5434 |
| 34 | Ga0466710_366882 | 3300042613 | Bacteria | 1022 |
| 35 | Ga0466728_217653 | 3300042620 | Bacteria | 6503 |
| 36 | Ga0123355_10654167 | 3300009826 | Bacteria | 1225 |
| 37 | Ga0123353_10001225 | 3300010167 | Bacteria | 31431 |
| 38 | Ga0123353_10079432 | 3300010167 | Bacteria | 5274 |
| 39 | Ga0123353_10489865 | 3300010167 | Unclassified | 1795 |
| 40 | IMNBGM34_c001898 | 3300000036 | Bacteria | 3252 |
| 41 | Ga0068305_10051920 | 3300005083 | Bacteria | 15549 |
| 42 | Ga0072941_1141717 | 3300005201 | Bacteria | 2699 |
| 43 | Ga0466701_086038 | 3300042598 | Bacteria | 7637 |
| 44 | Ga0466700_187945 | 3300042600 | Unclassified | 4691 |
| 45 | Ga0466716_095353 | 3300042605 | Bacteria | 11533 |
| 46 | Ga0466697_011700 | 3300042611 | Unclassified | 2053 |
| 47 | Ga0466731_011688 | 3300042622 | Unclassified | 4076 |
| 48 | Ga0466731_208258 | 3300042622 | Bacteria | 1366 |
| 49 | Ga0466704_283676 | 3300042643 | Bacteria | 21721 |
| 50 | Ga0466708_064170 | 3300042652 | Bacteria | 4007 |
| 51 | Ga0466695_082464 | 3300042595 | Unclassified | 1580 |
| 52 | Ga0466696_296990 | 3300042596 | Bacteria | 8818 |
| 53 | Ga0466711_163842 | 3300042615 | Unclassified | 25990 |
| 54 | Ga0466729_180837 | 3300042621 | Unclassified | 1812 |
| 55 | Ga0466729_194014 | 3300042621 | Bacteria | 10436 |
| 56 | Ga0123356_10860573 | 3300010049 | Bacteria | 1078 |
| 57 | Ga0123353_10003465 | 3300010167 | Bacteria | 19949 |
| 58 | Ga0123353_10986154 | 3300010167 | Bacteria | 1134 |
| 59 | Ga0466701_028616 | 3300042598 | Unclassified | 6067 |
| 60 | Ga0466707_022499 | 3300042601 | Bacteria | 2356 |
| 61 | Ga0466717_096370 | 3300042604 | Bacteria | 1052 |
| 62 | Ga0466698_461719 | 3300042610 | Unclassified | 1007 |
| 63 | Ga0466729_251294 | 3300042621 | Unclassified | 2479 |
| 64 | Ga0466734_116116 | 3300042623 | Bacteria | 1365 |
| 65 | Ga0466704_252756 | 3300042643 | Bacteria | 30859 |
| 66 | Ga0456237_0014230 | 3300041968 | Bacteria | 1134 |
| 67 | Ga0466692_112129 | 3300042591 | Bacteria | 106802 |
| 68 | Ga0466694_030584 | 3300042594 | Bacteria | 71743 |
| 69 | Ga0466695_123578 | 3300042595 | Bacteria | 2371 |
| 70 | Ga0466711_287569 | 3300042615 | Bacteria | 2872 |
| 71 | Ga0466715_279907 | 3300042616 | Bacteria | 14280 |
| 72 | Ga0123357_10079719 | 3300009784 | Bacteria | 4310 |
| 73 | Ga0123356_10038250 | 3300010049 | Unclassified | 4471 |
| 74 | Ga0123356_10460329 | 3300010049 | Bacteria | 1422 |
| 75 | Ga0123353_10008101 | 3300010167 | Bacteria | 14307 |
| 76 | Ga0123353_10336283 | 3300010167 | Unclassified | 2283 |
| 77 | Ga0123353_10409777 | 3300010167 | Unclassified | 2013 |
| 78 | Ga0123354_10169257 | 3300010882 | Bacteria | 2552 |
| 79 | JGI24702J35022_10002643 | 3300002462 | Bacteria | 10873 |
| 80 | JGI24702J35022_10022303 | 3300002462 | Bacteria | 3428 |
| 81 | Ga0466707_243479 | 3300042601 | Unclassified | 4369 |
| 82 | Ga0466717_208458 | 3300042604 | Bacteria | 1157 |
| 83 | Ga0466717_267232 | 3300042604 | Bacteria | 1468 |
| 84 | Ga0466729_246071 | 3300042621 | Bacteria | 1373 |
| 85 | Ga0466734_170059 | 3300042623 | Bacteria | 1632 |
| 86 | Ga0466735_043500 | 3300042624 | Bacteria | 3166 |
| 87 | Ga0466703_353309 | 3300042636 | Bacteria | 5292 |
| 88 | Ga0466709_221860 | 3300042648 | Bacteria | 264751 |
| 89 | Ga0466724_66829 | 3300042649 | Unclassified | 11500 |
| 90 | Ga0466727_216682 | 3300042655 | Unclassified | 1358 |
| 91 | Ga0466732_430226 | 3300042656 | Bacteria | 3089 |
| 92 | Ga0466693_060268 | 3300042592 | Unclassified | 1906 |
| 93 | Ga0466696_119935 | 3300042596 | Unclassified | 11438 |
| 94 | Ga0466710_091408 | 3300042613 | Bacteria | 1178 |
| 95 | Ga0466710_161364 | 3300042613 | Unclassified | 1628 |
| 96 | Ga0466711_010350 | 3300042615 | Unclassified | 1855 |
| 97 | Ga0466723_030796 | 3300042618 | Unclassified | 10342 |
| 98 | Ga0123353_10000126 | 3300010167 | Bacteria | 92081 |
| 99 | Ga0123353_10057017 | 3300010167 | Bacteria | 6255 |
| 100 | JGI24695J34938_10048937 | 3300002450 | Unclassified | 1860 |
| 101 | JGI24705J35276_12207046 | 3300002504 | Unclassified | 1735 |
| 102 | Ga0466716_086810 | 3300042605 | Bacteria | 5331 |
| 103 | Ga0466719_129152 | 3300042606 | Unclassified | 12772 |
| 104 | Ga0466698_009373 | 3300042610 | Bacteria | 3026 |
| 105 | Ga0466698_362972 | 3300042610 | Unclassified | 4271 |
| 106 | Ga0466729_255106 | 3300042621 | Bacteria | 3648 |
| 107 | Ga0466703_314379 | 3300042636 | Unclassified | 4977 |
| 108 | Ga0466690_154679 | 3300042590 | Unclassified | 13586 |
| 109 | Ga0466691_175677 | 3300042593 | Bacteria | 4665 |
| 110 | Ga0466695_288896 | 3300042595 | Bacteria | 1096 |
| 111 | Ga0123356_10002537 | 3300010049 | Unclassified | 19524 |
| 112 | Ga0123356_10006301 | 3300010049 | Bacteria | 11983 |
| 113 | Ga0123356_10014060 | 3300010049 | Bacteria | 7698 |
| 114 | Ga0123353_10001063 | 3300010167 | Bacteria | 33586 |
| 115 | Ga0123353_10001578 | 3300010167 | Bacteria | 28002 |
| 116 | Ga0123353_10195484 | 3300010167 | Bacteria | 3189 |
| 117 | JGI24702J35022_10003986 | 3300002462 | Bacteria | 8860 |
| 118 | Ga0466707_176162 | 3300042601 | Bacteria | 62223 |
| 119 | Ga0466703_079306 | 3300042636 | Unclassified | 3287 |
| 120 | Ga0466703_265048 | 3300042636 | Bacteria | 5345 |
| 121 | Ga0466704_537011 | 3300042643 | Bacteria | 42748 |
| 122 | Ga0466724_60958 | 3300042649 | Bacteria | 1202 |
| 123 | Ga0466727_018499 | 3300042655 | Bacteria | 8092 |
| 124 | Ga0466693_402616 | 3300042592 | Bacteria | 3153 |
| 125 | Ga0466699_120795 | 3300042597 | Bacteria | 2047 |
| 126 | Ga0466710_102558 | 3300042613 | Unclassified | 3095 |
| 127 | Ga0466710_299649 | 3300042613 | Bacteria | 1368 |
| 128 | Ga0466712_085821 | 3300042614 | Bacteria | 1945 |
| 129 | Ga0466715_040454 | 3300042616 | Bacteria | 1793 |
| 130 | Ga0466718_113583 | 3300042617 | Bacteria | 5259 |
| 131 | Ga0466723_130567 | 3300042618 | Bacteria | 18107 |
| 132 | Ga0466726_239056 | 3300042619 | Bacteria | 21787 |
| 133 | Ga0123356_10218801 | 3300010049 | Unclassified | 1959 |
| 134 | Ga0123353_10037508 | 3300010167 | Bacteria | 7604 |
| 135 | Ga0123353_10117500 | 3300010167 | Bacteria | 4278 |
| 136 | Ga0466716_139312 | 3300042605 | Unclassified | 1632 |
| 137 | Ga0466719_208254 | 3300042606 | Bacteria | 2667 |
| 138 | Ga0466697_065032 | 3300042611 | Unclassified | 2583 |
| 139 | Ga0466705_284043 | 3300042612 | Unclassified | 7450 |
| 140 | Ga0466735_138616 | 3300042624 | Bacteria | 7928 |
| 141 | Ga0466708_235373 | 3300042652 | Bacteria | 9618 |
| 142 | Ga0466727_305031 | 3300042655 | Bacteria | 1380 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.