Protein Family IF03181
Metagenome
Isolate
113
Members
37
Samples
99
Scaffolds
284.4
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10178887|Ga0123353_101788872
- Length
- 310 aa
- Sequence
- MTSEADRIPGNVSYKSIIRQGEISGALFNWKKMKKKDIPGIEDLLFSIEENYVSACGRFLARNDSKDIIWLLRNKNDICSLIINSRSTVIPVLAAKTPLLYSRNELINQLIRLKSFFKTKNIHSVQGLKEEVIIMEEAINHAGKKPVDTIDYDLMSLDKLPVSYTKFPNLVLKIPQLTDIDAIAPLQAAYEQEEVIPKGSVFSPAASRANISNIIANGRILAAQLDGRMIGKINVSAVSFTRYLVGGVYVHRDFRGLGIARRMASEFIASLINEGKAITLFVKKNNIAARRLYAGLGFTANADYRIIYY*
Sample Types
Isolate
12.4%
Metagenome
87.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
54.3%
Unclassified
40.0%
Rhinotermitidae
5.7%
Taxonomy
Archaea
2
Bacteria
108
Eukaryota
0
Viruses
1
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 2 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 7 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 8 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 9 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 10 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 20 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 21 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 22 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 23 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 24 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 25 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 26 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 27 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 28 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 29 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 30 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 31 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 32 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 33 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 34 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 35 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 36 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 37 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10008563 | 3300010049 | Bacteria | 10151 |
| 2 | Ga0123356_10054946 | 3300010049 | Bacteria | 3708 |
| 3 | Ga0466712_049935 | 3300042614 | Bacteria | 22184 |
| 4 | Ga0466718_036308 | 3300042617 | Bacteria | 1225 |
| 5 | Ga0466718_157200 | 3300042617 | Bacteria | 4356 |
| 6 | Ga0466718_157935 | 3300042617 | Bacteria | 7797 |
| 7 | JGI24698J34947_10125826 | 3300002449 | Bacteria | 1104 |
| 8 | Ga0466702_444680 | 3300042635 | Bacteria | 1480 |
| 9 | Ga0264413_106634 | 3300024493 | Bacteria | 8570 |
| 10 | Ga0466693_292178 | 3300042592 | Bacteria | 6647 |
| 11 | Ga0466699_335643 | 3300042597 | Bacteria | 3843 |
| 12 | Ga0123356_10094180 | 3300010049 | Bacteria | 2859 |
| 13 | Ga0123353_10178887 | 3300010167 | Bacteria | 3360 |
| 14 | Ga0466712_062453 | 3300042614 | Bacteria | 15282 |
| 15 | Ga0466718_065937 | 3300042617 | Bacteria | 1180 |
| 16 | Ga0466718_080690 | 3300042617 | Bacteria | 2861 |
| 17 | Ga0466718_156484 | 3300042617 | Bacteria | 3386 |
| 18 | JGI24698J34947_10022891 | 3300002449 | Archaea | 3345 |
| 19 | JGI24695J34938_10000139 | 3300002450 | Bacteria | 65941 |
| 20 | JGI24695J34938_10000416 | 3300002450 | Bacteria | 41447 |
| 21 | JGI24695J34938_10000969 | 3300002450 | Bacteria | 26153 |
| 22 | JGI24695J34938_10007009 | 3300002450 | Bacteria | 6680 |
| 23 | JGI24695J34938_10022082 | 3300002450 | Bacteria | 3099 |
| 24 | Ga0074263_105945 | 3300005485 | Bacteria | 1509 |
| 25 | Ga0466731_051592 | 3300042622 | Bacteria | 14951 |
| 26 | Ga0466731_336562 | 3300042622 | Bacteria | 1296 |
| 27 | Ga0264413_141047 | 3300024493 | Bacteria | 2617 |
| 28 | Ga0466692_146209 | 3300042591 | Bacteria | 16288 |
| 29 | Ga0466699_144341 | 3300042597 | Bacteria | 12054 |
| 30 | Ga0466712_095977 | 3300042614 | Bacteria | 1867 |
| 31 | JGI24698J34947_10084932 | 3300002449 | Bacteria | 1472 |
| 32 | JGI24695J34938_10000117 | 3300002450 | Bacteria | 71696 |
| 33 | Ga0072941_1006464 | 3300005201 | Bacteria | 5643 |
| 34 | Ga0466694_029811 | 3300042594 | Bacteria | 1315 |
| 35 | Ga0466699_070397 | 3300042597 | Bacteria | 6914 |
| 36 | Ga0466699_359082 | 3300042597 | Bacteria | 2233 |
| 37 | Ga0123356_10000368 | 3300010049 | Bacteria | 51439 |
| 38 | Ga0466718_030442 | 3300042617 | Bacteria | 1208 |
| 39 | AustNasuHG_c1001783 | 3300000089 | Bacteria | 7794 |
| 40 | JGI24695J34938_10005015 | 3300002450 | Bacteria | 8426 |
| 41 | JGI24695J34938_10068422 | 3300002450 | Bacteria | 1491 |
| 42 | Ga0072940_1085202 | 3300005200 | Bacteria | 2186 |
| 43 | Ga0072941_1078735 | 3300005201 | Bacteria | 8475 |
| 44 | Ga0415639_040130 | 3300038395 | Bacteria | 2390 |
| 45 | Ga0466694_010995 | 3300042594 | Bacteria | 2793 |
| 46 | Ga0123356_10000679 | 3300010049 | Bacteria | 37707 |
| 47 | Ga0123356_10000784 | 3300010049 | Bacteria | 35203 |
| 48 | Ga0466712_130080 | 3300042614 | Bacteria | 11647 |
| 49 | Ga0466700_195698 | 3300042600 | Bacteria | 10787 |
| 50 | JGI24695J34938_10000080 | 3300002450 | Bacteria | 82616 |
| 51 | JGI24695J34938_10000183 | 3300002450 | Bacteria | 58582 |
| 52 | JGI24695J34938_10025588 | 3300002450 | Bacteria | 2819 |
| 53 | Ga0072940_1020248 | 3300005200 | Bacteria | 3777 |
| 54 | Ga0415639_002275 | 3300038395 | Unclassified | 9245 |
| 55 | Ga0415639_128714 | 3300038395 | Bacteria | 5111 |
| 56 | Ga0415639_210105 | 3300038395 | Bacteria | 2557 |
| 57 | Ga0466694_296354 | 3300042594 | Archaea | 3501 |
| 58 | Ga0466712_136584 | 3300042614 | Bacteria | 18932 |
| 59 | Ga0466718_088627 | 3300042617 | Bacteria | 1515 |
| 60 | Ga0466720_110889 | 3300042607 | Bacteria | 14555 |
| 61 | AustNasuHG_c1000321 | 3300000089 | Bacteria | 16678 |
| 62 | JGI24695J34938_10000052 | 3300002450 | Bacteria | 90676 |
| 63 | JGI24695J34938_10000191 | 3300002450 | Bacteria | 57182 |
| 64 | JGI24695J34938_10082310 | 3300002450 | Bacteria | 1328 |
| 65 | Ga0072940_1072847 | 3300005200 | Bacteria | 7170 |
| 66 | Ga0466731_394706 | 3300042622 | Bacteria | 2067 |
| 67 | Ga0466702_309615 | 3300042635 | Bacteria | 3079 |
| 68 | Ga0264413_107168 | 3300024493 | Bacteria | 47740 |
| 69 | Ga0466699_074060 | 3300042597 | Bacteria | 6931 |
| 70 | Ga0123356_10006238 | 3300010049 | Bacteria | 12045 |
| 71 | Ga0123356_10079776 | 3300010049 | Bacteria | 3093 |
| 72 | Ga0123356_10379613 | 3300010049 | Bacteria | 1545 |
| 73 | Ga0466718_064720 | 3300042617 | Bacteria | 3777 |
| 74 | Ga0466718_086901 | 3300042617 | Bacteria | 3168 |
| 75 | Ga0466720_121395 | 3300042607 | Bacteria | 24520 |
| 76 | Ga0466721_218731 | 3300042608 | Bacteria | 30688 |
| 77 | JGI24695J34938_10001009 | 3300002450 | Bacteria | 25530 |
| 78 | JGI24695J34938_10054507 | 3300002450 | Bacteria | 1733 |
| 79 | JGI24695J34938_10068442 | 3300002450 | Bacteria | 1491 |
| 80 | Ga0072941_1004833 | 3300005201 | Bacteria | 19559 |
| 81 | Ga0466702_240224 | 3300042635 | Bacteria | 13531 |
| 82 | Ga0466694_198818 | 3300042594 | Bacteria | 1312 |
| 83 | Ga0466699_249878 | 3300042597 | Bacteria | 9041 |
| 84 | Ga0466699_305109 | 3300042597 | Bacteria | 5974 |
| 85 | Ga0466699_397522 | 3300042597 | Viruses | 1680 |
| 86 | Ga0466732_263396 | 3300042656 | Bacteria | 1135 |
| 87 | Ga0123356_10008782 | 3300010049 | Bacteria | 10014 |
| 88 | Ga0123356_10036223 | 3300010049 | Bacteria | 4607 |
| 89 | Ga0466718_023348 | 3300042617 | Bacteria | 1097 |
| 90 | JGI24695J34938_10000010 | 3300002450 | Bacteria | 132147 |
| 91 | JGI24695J34938_10000143 | 3300002450 | Bacteria | 65111 |
| 92 | JGI24695J34938_10000174 | 3300002450 | Bacteria | 59663 |
| 93 | JGI24695J34938_10040771 | 3300002450 | Bacteria | 2089 |
| 94 | Ga0072940_1120704 | 3300005200 | Bacteria | 7406 |
| 95 | Ga0072941_1000768 | 3300005201 | Bacteria | 12841 |
| 96 | Ga0466731_368474 | 3300042622 | Bacteria | 2749 |
| 97 | Ga0456237_0003665 | 3300041968 | Unclassified | 2479 |
| 98 | Ga0466692_136137 | 3300042591 | Bacteria | 29826 |
| 99 | Ga0466693_366681 | 3300042592 | Bacteria | 24175 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF08445 | FR47 | FR47-like protein | 245 | 301 | 0.93 |
| PF13673 | Acetyltransf_10 | Acetyltransferase (GNAT) domain | 188 | 300 | 0.87 |
| PF00583 | Acetyltransf_1 | Acetyltransferase (GNAT) family | 216 | 298 | 0.87 |
| PF13302 | Acetyltransf_3 | Acetyltransferase (GNAT) domain | 170 | 299 | 0.85 |
| PF13508 | Acetyltransf_7 | Acetyltransferase (GNAT) domain | 217 | 299 | 0.76 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08445 | GO:0016747 | acyltransferase activity, transferring groups other than amino-acyl groups | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.