Protein Family IF03172
Metagenome
Isolate
120
Members
32
Samples
111
Scaffolds
158.72
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10164798|Ga0123353_101647983
- Length
- 181 aa
- Sequence
- VFSVVKFLLIGTASFLFTFGGNMSEAEEIQNETTDSSNTEKYLIFSIMGKLYSFQSRFIGEIALFDAVYPLPLMPSYVLGVVNRYSVPYALFDIGLLFYNVPSPRNKVLIVKDEIDRIAFLIDDITGIADIQQDNVLTIDKNTETNDLSEVVCASFNWNNSDVFVIDIHKILSRVSGDTV*
Sample Types
Isolate
7.5%
Metagenome
92.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
62.1%
Unclassified
31.0%
Termopsidae
3.4%
Rhinotermitidae
3.4%
Taxonomy
Archaea
1
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 6 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 12 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 13 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 14 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 15 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 16 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 17 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 21 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 22 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 23 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 24 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 25 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 26 | 2228664018 | Amitermes wheeleri hindgut microbial communities from Arizona, USA - 3 | Metagenome | Termitidae |
| 27 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 28 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 29 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 32 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_121164 | 3300042614 | Bacteria | 12103 |
| 2 | Ga0466718_088598 | 3300042617 | Unclassified | 1617 |
| 3 | Ga0466718_098793 | 3300042617 | Unclassified | 13313 |
| 4 | Ga0466718_117063 | 3300042617 | Bacteria | 1379 |
| 5 | Ga0466718_132134 | 3300042617 | Bacteria | 1402 |
| 6 | Ga0466718_140139 | 3300042617 | Bacteria | 3334 |
| 7 | JGI24698J34947_10000583 | 3300002449 | Unclassified | 17389 |
| 8 | JGI24695J34938_10000362 | 3300002450 | Bacteria | 44977 |
| 9 | JGI24695J34938_10025148 | 3300002450 | Bacteria | 2850 |
| 10 | Ga0072941_1047076 | 3300005201 | Unclassified | 7240 |
| 11 | Ga0264413_122562 | 3300024493 | Bacteria | 1340 |
| 12 | Ga0466694_167851 | 3300042594 | Bacteria | 1739 |
| 13 | Ga0466694_228820 | 3300042594 | Bacteria | 2154 |
| 14 | Ga0466702_032696 | 3300042635 | Bacteria | 25956 |
| 15 | Ga0466712_009154 | 3300042614 | Bacteria | 12593 |
| 16 | Ga0466712_139157 | 3300042614 | Bacteria | 70891 |
| 17 | Ga0123356_10096061 | 3300010049 | Bacteria | 2833 |
| 18 | Ga0123356_11302742 | 3300010049 | Bacteria | 890 |
| 19 | Ga0466720_238860 | 3300042607 | Bacteria | 102895 |
| 20 | Ga0466722_110032 | 3300042609 | Bacteria | 4437 |
| 21 | Ga0466722_223700 | 3300042609 | Bacteria | 1683 |
| 22 | 2230930451 | 2228664001 | Bacteria | 1359 |
| 23 | AustNasuHG_c1009737 | 3300000089 | Bacteria | 3367 |
| 24 | JGI24698J34947_10140623 | 3300002449 | Bacteria | 1017 |
| 25 | JGI24695J34938_10020009 | 3300002450 | Bacteria | 3302 |
| 26 | Ga0072940_1093864 | 3300005200 | Bacteria | 1656 |
| 27 | Ga0072940_1097716 | 3300005200 | Bacteria | 2093 |
| 28 | Ga0072941_1123889 | 3300005201 | Bacteria | 2582 |
| 29 | Ga0264413_104630 | 3300024493 | Bacteria | 21539 |
| 30 | Ga0264413_143060 | 3300024493 | Bacteria | 2109 |
| 31 | Ga0264413_146222 | 3300024493 | Bacteria | 5685 |
| 32 | Ga0466694_043533 | 3300042594 | Bacteria | 1452 |
| 33 | Ga0466694_254665 | 3300042594 | Bacteria | 2660 |
| 34 | Ga0466718_008133 | 3300042617 | Bacteria | 1978 |
| 35 | JGI24698J34947_10000172 | 3300002449 | Bacteria | 25168 |
| 36 | JGI24698J34947_10070979 | 3300002449 | Unclassified | 1673 |
| 37 | Ga0072941_1047264 | 3300005201 | Bacteria | 11760 |
| 38 | Ga0072941_1109482 | 3300005201 | Bacteria | 3685 |
| 39 | Ga0264413_114538 | 3300024493 | Bacteria | 3897 |
| 40 | Ga0264413_115420 | 3300024493 | Bacteria | 3737 |
| 41 | Ga0264413_117180 | 3300024493 | Bacteria | 4423 |
| 42 | Ga0466694_300610 | 3300042594 | Bacteria | 9816 |
| 43 | Ga0466731_013174 | 3300042622 | Archaea | 3951 |
| 44 | Ga0466712_125699 | 3300042614 | Bacteria | 25129 |
| 45 | Ga0466718_100898 | 3300042617 | Bacteria | 1772 |
| 46 | Ga0123353_10164798 | 3300010167 | Bacteria | 3525 |
| 47 | Ga0466722_006411 | 3300042609 | Bacteria | 1609 |
| 48 | Ga0466722_229691 | 3300042609 | Bacteria | 16483 |
| 49 | AmiMGMT1_c408772 | 2228664018 | Bacteria | 740 |
| 50 | AustNasuHG_c1000265 | 3300000089 | Bacteria | 17876 |
| 51 | AustNasuHG_c1012972 | 3300000089 | Unclassified | 2867 |
| 52 | AustNasuHG_c1031598 | 3300000089 | Bacteria | 1491 |
| 53 | JGI24695J34938_10000788 | 3300002450 | Bacteria | 29542 |
| 54 | Ga0466694_292061 | 3300042594 | Bacteria | 1263 |
| 55 | Ga0466694_334142 | 3300042594 | Bacteria | 1591 |
| 56 | Ga0466699_173755 | 3300042597 | Bacteria | 16288 |
| 57 | Ga0466712_120904 | 3300042614 | Bacteria | 41551 |
| 58 | Ga0466718_052579 | 3300042617 | Bacteria | 1621 |
| 59 | Ga0466718_094035 | 3300042617 | Bacteria | 2247 |
| 60 | Ga0123356_11879385 | 3300010049 | Bacteria | 745 |
| 61 | Ga0466720_007144 | 3300042607 | Bacteria | 8622 |
| 62 | AustNasuHG_c1030900 | 3300000089 | Bacteria | 1527 |
| 63 | Ga0264413_103252 | 3300024493 | Bacteria | 22241 |
| 64 | Ga0264413_103253 | 3300024493 | Bacteria | 21621 |
| 65 | Ga0466702_053349 | 3300042635 | Bacteria | 5525 |
| 66 | Ga0466718_040530 | 3300042617 | Bacteria | 2015 |
| 67 | Ga0466718_122691 | 3300042617 | Bacteria | 2070 |
| 68 | Ga0123356_10844149 | 3300010049 | Bacteria | 1087 |
| 69 | Ga0123356_11888309 | 3300010049 | Bacteria | 743 |
| 70 | Ga0466720_238863 | 3300042607 | Bacteria | 49455 |
| 71 | Ga0466722_069949 | 3300042609 | Bacteria | 14031 |
| 72 | AustNasuHG_c1001349 | 3300000089 | Bacteria | 8801 |
| 73 | AustNasuHG_c1004812 | 3300000089 | Unclassified | 4836 |
| 74 | AustNasuHG_c1022267 | 3300000089 | Bacteria | 2038 |
| 75 | AustNasuHG_c1041195 | 3300000089 | Unclassified | 1117 |
| 76 | FAAS_10851814 | 3300001880 | Unclassified | 559 |
| 77 | JGI24698J34947_10104974 | 3300002449 | Bacteria | 1260 |
| 78 | JGI24695J34938_10000016 | 3300002450 | Bacteria | 116336 |
| 79 | JGI24695J34938_10035976 | 3300002450 | Bacteria | 2260 |
| 80 | JGI24702J35022_10138263 | 3300002462 | Bacteria | 1357 |
| 81 | Ga0072941_1035939 | 3300005201 | Bacteria | 13220 |
| 82 | Ga0074263_132145 | 3300005485 | Bacteria | 772 |
| 83 | Ga0264413_101607 | 3300024493 | Unclassified | 6402 |
| 84 | Ga0466694_212426 | 3300042594 | Bacteria | 11273 |
| 85 | Ga0466699_123417 | 3300042597 | Bacteria | 3890 |
| 86 | Ga0466699_410952 | 3300042597 | Bacteria | 1825 |
| 87 | Ga0466718_030577 | 3300042617 | Bacteria | 14715 |
| 88 | Ga0466726_359994 | 3300042619 | Bacteria | 2912 |
| 89 | Ga0123356_10002170 | 3300010049 | Bacteria | 21119 |
| 90 | Ga0123356_10198860 | 3300010049 | Bacteria | 2042 |
| 91 | Ga0466720_019228 | 3300042607 | Bacteria | 36389 |
| 92 | Ga0466720_124771 | 3300042607 | Bacteria | 15693 |
| 93 | Ga0466722_103145 | 3300042609 | Bacteria | 1507 |
| 94 | Ga0466722_122345 | 3300042609 | Bacteria | 2825 |
| 95 | AustNasuHG_c1011870 | 3300000089 | Unclassified | 3015 |
| 96 | Ga0072940_1038685 | 3300005200 | Bacteria | 1897 |
| 97 | Ga0072941_1008776 | 3300005201 | Bacteria | 26268 |
| 98 | Ga0072941_1010991 | 3300005201 | Bacteria | 13928 |
| 99 | Ga0264413_107563 | 3300024493 | Bacteria | 8657 |
| 100 | Ga0264413_111622 | 3300024493 | Bacteria | 4971 |
| 101 | Ga0466694_204189 | 3300042594 | Bacteria | 2587 |
| 102 | Ga0466699_402771 | 3300042597 | Bacteria | 21868 |
| 103 | Ga0466718_037866 | 3300042617 | Bacteria | 1525 |
| 104 | Ga0466718_076430 | 3300042617 | Bacteria | 13169 |
| 105 | Ga0466720_129712 | 3300042607 | Bacteria | 7759 |
| 106 | Ga0466720_149890 | 3300042607 | Bacteria | 1462 |
| 107 | JGI24695J34938_10000021 | 3300002450 | Bacteria | 112419 |
| 108 | JGI24695J34938_10000601 | 3300002450 | Bacteria | 34636 |
| 109 | JGI24695J34938_10005853 | 3300002450 | Bacteria | 7562 |
| 110 | JGI24697J35500_10751983 | 3300002507 | Bacteria | 675 |
| 111 | Ga0466699_416581 | 3300042597 | Bacteria | 31777 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01584 | CheW | CheW-like domain | 41 | 174 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.