Protein Family IF03160
Metagenome
Isolate
105
Members
46
Samples
102
Scaffolds
484.45
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10135499|Ga0123353_101354995
- Length
- 527 aa
- Sequence
- MKNCDISCQEMQKSKSACRYGRQAWMHFYKKCFFVYHNVLSKKRSDMFYRQKFDTFIRIYDGDVGYIVNKSNYNDRVTEGSGALFFAALSRNPKSIDALTDEIAQKFSDVEKNELQKDIVEFFGILEDDGFIVSSNNVEELDQKDKRFSYTDLVPKTIKTDFTPQVQRAQKSSQKYLEEHFKDSPHLMSIQIELSSRCNERCLHCYIPHENKNSDIEPALFYEVMEQCREMGVLGLTLSGGEPMLHQNFCEFLRKAKEYDFSINILSNLTLLNDDIITEMKENRLSSVQVSLYSLNPEIHDSITQLKGSFYKTRDNILRLIENNIPLQISCPTMKQNRNCFADVMKWAHEHKCRASTDYVMMARYDHTTDNLDNRLSLDEVGKIINEVISLNNNYQKMILSDSFEEQESRDRSDDLVCGVCVSSICMVANGNVYPCPGWQSYICGNVKETPLKEIWNNSPKVKYLRGLRKKDFPKCRNCEDKGFCVMCMVRNANENPDGDPLKINEHFCKVAALNRKIVMDWKKKN*
Sample Types
Isolate
2.9%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.2%
Kalotermitidae
27.3%
Unclassified
11.4%
Termopsidae
9.1%
Rhinotermitidae
6.8%
Hodotermitidae
2.3%
Taxonomy
Archaea
1
Bacteria
95
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 7 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 12 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 29 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 30 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 31 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 32 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 33 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 34 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 35 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 36 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 37 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 38 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 39 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 40 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10000295 | 3300010049 | Bacteria | 57433 |
| 2 | Ga0466699_270219 | 3300042597 | Bacteria | 5347 |
| 3 | Ga0466705_514065 | 3300042612 | Bacteria | 3258 |
| 4 | Ga0466712_034812 | 3300042614 | Bacteria | 5808 |
| 5 | Ga0466723_352708 | 3300042618 | Bacteria | 2109 |
| 6 | Ga0466726_109032 | 3300042619 | Bacteria | 2759 |
| 7 | Ga0466726_247308 | 3300042619 | Bacteria | 3213 |
| 8 | JGI24695J34938_10004452 | 3300002450 | Unclassified | 9174 |
| 9 | JGI24695J34938_10017336 | 3300002450 | Bacteria | 3632 |
| 10 | Ga0466716_282523 | 3300042605 | Bacteria | 3841 |
| 11 | Ga0466722_211804 | 3300042609 | Bacteria | 3802 |
| 12 | Ga0466702_309842 | 3300042635 | Bacteria | 2163 |
| 13 | Ga0466703_001098 | 3300042636 | Bacteria | 2331 |
| 14 | Ga0466704_061447 | 3300042643 | Bacteria | 4722 |
| 15 | Ga0466704_553846 | 3300042643 | Unclassified | 3597 |
| 16 | Ga0466709_315050 | 3300042648 | Bacteria | 6139 |
| 17 | Ga0466691_082857 | 3300042593 | Archaea | 7125 |
| 18 | Ga0466694_174761 | 3300042594 | Bacteria | 2152 |
| 19 | Ga0466712_112126 | 3300042614 | Bacteria | 3750 |
| 20 | Ga0466711_152344 | 3300042615 | Bacteria | 3042 |
| 21 | JGI24695J34938_10012127 | 3300002450 | Bacteria | 4590 |
| 22 | Ga0466705_032166 | 3300042612 | Bacteria | 5749 |
| 23 | Ga0466705_370871 | 3300042612 | Bacteria | 3986 |
| 24 | Ga0123355_10013578 | 3300009826 | Bacteria | 12687 |
| 25 | Ga0123353_10135499 | 3300010167 | Bacteria | 3949 |
| 26 | Ga0466692_022630 | 3300042591 | Unclassified | 7051 |
| 27 | Ga0466699_270241 | 3300042597 | Bacteria | 2962 |
| 28 | Ga0466712_272910 | 3300042614 | Bacteria | 3664 |
| 29 | Ga0072941_1096376 | 3300005201 | Bacteria | 4793 |
| 30 | Ga0466707_297786 | 3300042601 | Bacteria | 1798 |
| 31 | Ga0466729_245066 | 3300042621 | Bacteria | 9429 |
| 32 | Ga0466734_096069 | 3300042623 | Bacteria | 1669 |
| 33 | Ga0466735_073880 | 3300042624 | Bacteria | 6127 |
| 34 | Ga0123353_10205339 | 3300010167 | Bacteria | 3096 |
| 35 | Ga0264413_135610 | 3300024493 | Unclassified | 1729 |
| 36 | Ga0415639_086178 | 3300038395 | Bacteria | 7527 |
| 37 | Ga0466692_040093 | 3300042591 | Bacteria | 6996 |
| 38 | Ga0466691_121433 | 3300042593 | Unclassified | 3875 |
| 39 | Ga0466711_206522 | 3300042615 | Bacteria | 5078 |
| 40 | Ga0466723_301295 | 3300042618 | Bacteria | 3580 |
| 41 | JGI24698J34947_10012021 | 3300002449 | Bacteria | 4753 |
| 42 | JGI24699J35502_11073533 | 3300002509 | Bacteria | 1875 |
| 43 | Ga0466720_138407 | 3300042607 | Bacteria | 18694 |
| 44 | Ga0466703_183638 | 3300042636 | Bacteria | 5511 |
| 45 | Ga0466732_062482 | 3300042656 | Bacteria | 5357 |
| 46 | Ga0264413_129090 | 3300024493 | Bacteria | 9003 |
| 47 | Ga0264413_144279 | 3300024493 | Bacteria | 7072 |
| 48 | Ga0466690_191710 | 3300042590 | Bacteria | 5766 |
| 49 | Ga0466692_070738 | 3300042591 | Unclassified | 2551 |
| 50 | Ga0466696_294782 | 3300042596 | Bacteria | 2910 |
| 51 | Ga0466699_116778 | 3300042597 | Bacteria | 16899 |
| 52 | Ga0466726_201324 | 3300042619 | Bacteria | 6115 |
| 53 | JGI24702J35022_10015967 | 3300002462 | Bacteria | 4123 |
| 54 | Ga0072941_1008934 | 3300005201 | Bacteria | 9263 |
| 55 | Ga0072941_1097360 | 3300005201 | Bacteria | 2586 |
| 56 | Ga0466720_020516 | 3300042607 | Bacteria | 14920 |
| 57 | Ga0466735_038467 | 3300042624 | Bacteria | 4473 |
| 58 | Ga0466703_301586 | 3300042636 | Bacteria | 6406 |
| 59 | Ga0466704_424131 | 3300042643 | Bacteria | 8817 |
| 60 | Ga0466727_000221 | 3300042655 | Bacteria | 2140 |
| 61 | Ga0466733_152283 | 3300042659 | Unclassified | 3917 |
| 62 | Ga0123353_10102327 | 3300010167 | Bacteria | 4617 |
| 63 | Ga0123354_10002419 | 3300010882 | Bacteria | 24626 |
| 64 | Ga0466690_247157 | 3300042590 | Bacteria | 1562 |
| 65 | Ga0466691_056075 | 3300042593 | Bacteria | 20512 |
| 66 | Ga0466699_155258 | 3300042597 | Bacteria | 5291 |
| 67 | Ga0466711_029868 | 3300042615 | Bacteria | 2271 |
| 68 | JGI24698J34947_10002237 | 3300002449 | Bacteria | 10365 |
| 69 | JGI24698J34947_10034488 | 3300002449 | Bacteria | 2648 |
| 70 | JGI24702J35022_10052391 | 3300002462 | Bacteria | 2175 |
| 71 | Ga0072941_1136816 | 3300005201 | Bacteria | 2602 |
| 72 | Ga0072941_1142063 | 3300005201 | Bacteria | 2767 |
| 73 | Ga0466704_136725 | 3300042643 | Bacteria | 2928 |
| 74 | Ga0466704_345530 | 3300042643 | Bacteria | 7586 |
| 75 | Ga0466705_013743 | 3300042612 | Bacteria | 4465 |
| 76 | Ga0123356_10135231 | 3300010049 | Bacteria | 2422 |
| 77 | Ga0123354_10156142 | 3300010882 | Bacteria | 2736 |
| 78 | Ga0466711_098873 | 3300042615 | Bacteria | 3586 |
| 79 | Ga0466711_287771 | 3300042615 | Bacteria | 8974 |
| 80 | Ga0466718_127932 | 3300042617 | Bacteria | 3098 |
| 81 | Ga0466726_032341 | 3300042619 | Bacteria | 1625 |
| 82 | Ga0466728_328560 | 3300042620 | Unclassified | 2888 |
| 83 | Ga0068302_10216161 | 3300005071 | Bacteria | 1921 |
| 84 | Ga0068305_10016692 | 3300005083 | Bacteria | 3997 |
| 85 | Ga0072941_1262427 | 3300005201 | Bacteria | 2426 |
| 86 | Ga0466707_364255 | 3300042601 | Bacteria | 2089 |
| 87 | Ga0466703_093469 | 3300042636 | Bacteria | 9262 |
| 88 | Ga0466703_353198 | 3300042636 | Bacteria | 6885 |
| 89 | Ga0466708_081690 | 3300042652 | Bacteria | 2956 |
| 90 | Ga0123353_10529257 | 3300010167 | Bacteria | 1707 |
| 91 | Ga0264413_117649 | 3300024493 | Bacteria | 3187 |
| 92 | Ga0466696_160429 | 3300042596 | Bacteria | 3318 |
| 93 | Ga0466712_015602 | 3300042614 | Unclassified | 2273 |
| 94 | AustNasuHG_c1022841 | 3300000089 | Bacteria | 2004 |
| 95 | JGI24698J34947_10028611 | 3300002449 | Bacteria | 2950 |
| 96 | JGI24698J34947_10071378 | 3300002449 | Bacteria | 1667 |
| 97 | Ga0466706_260300 | 3300042599 | Bacteria | 2917 |
| 98 | Ga0466707_381473 | 3300042601 | Bacteria | 1618 |
| 99 | Ga0466720_024290 | 3300042607 | Bacteria | 5131 |
| 100 | Ga0466735_074769 | 3300042624 | Bacteria | 2175 |
| 101 | Ga0466704_253633 | 3300042643 | Bacteria | 3737 |
| 102 | Ga0466727_001449 | 3300042655 | Bacteria | 9822 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300024493 | Ga0264413_135610 | Ga0264413_1356102 | 446 |
| 2 | 3300005201 | Ga0072941_1136816 | Ga0072941_11368163 | 447 |
| 3 | 3300042590 | Ga0466690_247157 | Ga0466690_247157_160_1512 | 450 |
| 4 | 3300005201 | Ga0072941_1142063 | Ga0072941_11420633 | 458 |
| 5 | 3300042618 | Ga0466723_352708 | Ga0466723_352708_673_2058 | 461 |
| 6 | 3300042605 | Ga0466716_282523 | Ga0466716_282523_1063_2505 | 463 |
| 7 | 3300042617 | Ga0466718_127932 | Ga0466718_127932_412_1866 | 465 |
| 8 | 3300042643 | Ga0466704_253633 | Ga0466704_253633_143_1594 | 465 |
| 9 | 3300042601 | Ga0466707_364255 | Ga0466707_364255_667_2070 | 467 |
| 10 | 3300042607 | Ga0466720_020516 | Ga0466720_020516_3348_4799 | 468 |
| 11 | 3300009826 | Ga0123355_10013578 | Ga0123355_100135789 | 469 |
| 12 | 3300024493 | Ga0264413_144279 | Ga0264413_1442791 | 469 |
| 13 | 3300042619 | Ga0466726_247308 | Ga0466726_247308_14_1426 | 470 |
| 14 | 3300042643 | Ga0466704_345530 | Ga0466704_345530_6016_7482 | 470 |
| 15 | 3300042635 | Ga0466702_309842 | Ga0466702_309842_48_1499 | 474 |
| 16 | 3300010167 | Ga0123353_10205339 | Ga0123353_102053393 | 475 |
| 17 | 3300038395 | Ga0415639_086178 | Ga0415639_086178_310_1770 | 475 |
| 18 | 3300010049 | Ga0123356_10000295 | Ga0123356_1000029532 | 477 |
| 19 | 3300042609 | Ga0466722_211804 | Ga0466722_211804_2067_3500 | 477 |
| 20 | 3300010882 | Ga0123354_10156142 | Ga0123354_101561423 | 479 |
| 21 | 3300042624 | Ga0466735_074769 | Ga0466735_074769_416_1885 | 480 |
| 22 | 3300010167 | Ga0123353_10102327 | Ga0123353_101023273 | 481 |
| 23 | 3300024493 | Ga0264413_129090 | Ga0264413_12909011 | 481 |
| 24 | 3300042624 | Ga0466735_038467 | Ga0466735_038467_274_1719 | 481 |
| 25 | iso_pr_bacteria | 2781125639 | 2781286080 | 481 |
| 26 | 3300002450 | JGI24695J34938_10017336 | JGI24695J34938_100173362 | 482 |
| 27 | 3300005071 | Ga0068302_10216161 | Ga0068302_102161612 | 482 |
| 28 | 3300024493 | Ga0264413_117649 | Ga0264413_1176494 | 482 |
| 29 | 3300042596 | Ga0466696_294782 | Ga0466696_294782_801_2249 | 482 |
| 30 | 3300042601 | Ga0466707_381473 | Ga0466707_381473_21_1469 | 482 |
| 31 | iso_pr_bacteria | 2781125658 | 2781325668 | 482 |
| 32 | 3300002449 | JGI24698J34947_10002237 | JGI24698J34947_1000223712 | 483 |
| 33 | 3300002449 | JGI24698J34947_10034488 | JGI24698J34947_100344882 | 483 |
| 34 | 3300002450 | JGI24695J34938_10012127 | JGI24695J34938_100121274 | 483 |
| 35 | 3300042597 | Ga0466699_116778 | Ga0466699_116778_14349_15800 | 483 |
| 36 | 3300042597 | Ga0466699_270219 | Ga0466699_270219_133_1584 | 483 |
| 37 | 3300042607 | Ga0466720_024290 | Ga0466720_024290_1619_3070 | 483 |
| 38 | 3300042607 | Ga0466720_138407 | Ga0466720_138407_11220_12671 | 483 |
| 39 | 3300042614 | Ga0466712_015602 | Ga0466712_015602_590_2041 | 483 |
| 40 | 3300042614 | Ga0466712_034812 | Ga0466712_034812_3145_4596 | 483 |
| 41 | 3300042614 | Ga0466712_112126 | Ga0466712_112126_446_1897 | 483 |
| 42 | 3300042636 | Ga0466703_093469 | Ga0466703_093469_6416_7867 | 483 |
| 43 | 3300042636 | Ga0466703_183638 | Ga0466703_183638_2488_3939 | 483 |
| 44 | 3300042636 | Ga0466703_301586 | Ga0466703_301586_3211_4662 | 483 |
| 45 | 3300042656 | Ga0466732_062482 | Ga0466732_062482_3414_4865 | 483 |
| 46 | iso_pr_bacteria | 2781125640 | 2781289111 | 483 |
| 47 | 3300002449 | JGI24698J34947_10012021 | JGI24698J34947_100120214 | 484 |
| 48 | 3300002449 | JGI24698J34947_10028611 | JGI24698J34947_100286114 | 484 |
| 49 | 3300002449 | JGI24698J34947_10071378 | JGI24698J34947_100713781 | 484 |
| 50 | 3300002462 | JGI24702J35022_10015967 | JGI24702J35022_100159674 | 484 |
| 51 | 3300002462 | JGI24702J35022_10052391 | JGI24702J35022_100523912 | 484 |
| 52 | 3300005201 | Ga0072941_1096376 | Ga0072941_10963763 | 484 |
| 53 | 3300005201 | Ga0072941_1097360 | Ga0072941_10973604 | 484 |
| 54 | 3300042591 | Ga0466692_022630 | Ga0466692_022630_3636_5090 | 484 |
| 55 | 3300042591 | Ga0466692_070738 | Ga0466692_070738_465_1919 | 484 |
| 56 | 3300042601 | Ga0466707_297786 | Ga0466707_297786_285_1739 | 484 |
| 57 | 3300042655 | Ga0466727_001449 | Ga0466727_001449_5290_6744 | 484 |
| 58 | 3300005201 | Ga0072941_1008934 | Ga0072941_10089342 | 485 |
| 59 | 3300010049 | Ga0123356_10135231 | Ga0123356_101352311 | 485 |
| 60 | 3300010167 | Ga0123353_10529257 | Ga0123353_105292572 | 485 |
| 61 | 3300042591 | Ga0466692_040093 | Ga0466692_040093_4092_5549 | 485 |
| 62 | 3300042593 | Ga0466691_056075 | Ga0466691_056075_10978_12435 | 485 |
| 63 | 3300042594 | Ga0466694_174761 | Ga0466694_174761_107_1564 | 485 |
| 64 | 3300042612 | Ga0466705_032166 | Ga0466705_032166_3590_5047 | 485 |
| 65 | 3300042615 | Ga0466711_029868 | Ga0466711_029868_392_1849 | 485 |
| 66 | 3300042615 | Ga0466711_206522 | Ga0466711_206522_1029_2486 | 485 |
| 67 | 3300042621 | Ga0466729_245066 | Ga0466729_245066_7016_8473 | 485 |
| 68 | 3300042636 | Ga0466703_353198 | Ga0466703_353198_3940_5397 | 485 |
| 69 | 3300042643 | Ga0466704_553846 | Ga0466704_553846_1381_2838 | 485 |
| 70 | 3300000089 | AustNasuHG_c1022841 | AustNasuHG_10228411 | 486 |
| 71 | 3300042612 | Ga0466705_370871 | Ga0466705_370871_2173_3633 | 486 |
| 72 | 3300042612 | Ga0466705_514065 | Ga0466705_514065_1321_2781 | 486 |
| 73 | 3300042620 | Ga0466728_328560 | Ga0466728_328560_70_1530 | 486 |
| 74 | 3300010882 | Ga0123354_10002419 | Ga0123354_1000241924 | 487 |
| 75 | 3300042624 | Ga0466735_073880 | Ga0466735_073880_1724_3187 | 487 |
| 76 | 3300005083 | Ga0068305_10016692 | Ga0068305_100166921 | 488 |
| 77 | 3300042615 | Ga0466711_152344 | Ga0466711_152344_266_1732 | 488 |
| 78 | 3300042618 | Ga0466723_301295 | Ga0466723_301295_2006_3472 | 488 |
| 79 | 3300042643 | Ga0466704_424131 | Ga0466704_424131_1594_3060 | 488 |
| 80 | 3300042619 | Ga0466726_032341 | Ga0466726_032341_73_1542 | 489 |
| 81 | 3300042643 | Ga0466704_136725 | Ga0466704_136725_933_2402 | 489 |
| 82 | 3300042590 | Ga0466690_191710 | Ga0466690_191710_1454_2926 | 490 |
| 83 | 3300042597 | Ga0466699_270241 | Ga0466699_270241_778_2250 | 490 |
| 84 | 3300042615 | Ga0466711_098873 | Ga0466711_098873_816_2288 | 490 |
| 85 | 3300042619 | Ga0466726_201324 | Ga0466726_201324_528_2000 | 490 |
| 86 | 3300042623 | Ga0466734_096069 | Ga0466734_096069_182_1654 | 490 |
| 87 | 3300042648 | Ga0466709_315050 | Ga0466709_315050_1158_2630 | 490 |
| 88 | 3300042593 | Ga0466691_082857 | Ga0466691_082857_2723_4198 | 491 |
| 89 | 3300042596 | Ga0466696_160429 | Ga0466696_160429_1228_2703 | 491 |
| 90 | 3300042599 | Ga0466706_260300 | Ga0466706_260300_377_1855 | 492 |
| 91 | 3300042597 | Ga0466699_155258 | Ga0466699_155258_526_2007 | 493 |
| 92 | 3300042659 | Ga0466733_152283 | Ga0466733_152283_306_1787 | 493 |
| 93 | 3300042652 | Ga0466708_081690 | Ga0466708_081690_1008_2492 | 494 |
| 94 | 3300042614 | Ga0466712_272910 | Ga0466712_272910_1285_2778 | 497 |
| 95 | 3300042643 | Ga0466704_061447 | Ga0466704_061447_1800_3296 | 498 |
| 96 | 3300042615 | Ga0466711_287771 | Ga0466711_287771_7275_8816 | 501 |
| 97 | 3300042655 | Ga0466727_000221 | Ga0466727_000221_191_1699 | 502 |
| 98 | 3300042619 | Ga0466726_109032 | Ga0466726_109032_951_2477 | 508 |
| 99 | 3300002450 | JGI24695J34938_10004452 | JGI24695J34938_100044524 | 509 |
| 100 | 3300042636 | Ga0466703_001098 | Ga0466703_001098_164_1696 | 510 |
| 101 | 3300042612 | Ga0466705_013743 | Ga0466705_013743_1749_3290 | 513 |
| 102 | 3300002509 | JGI24699J35502_11073533 | JGI24699J35502_110735332 | 514 |
| 103 | 3300042593 | Ga0466691_121433 | Ga0466691_121433_1300_2844 | 514 |
| 104 | 3300005201 | Ga0072941_1262427 | Ga0072941_12624271 | 522 |
| 105 | 3300010167 | Ga0123353_10135499 | Ga0123353_101354995 | 527 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.82 | 0.87 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.