Protein Family IF03143
Metagenome
Isolate
182
Members
48
Samples
180
Scaffolds
266.92
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10115084|Ga0123353_101150844
- Length
- 277 aa
- Sequence
- MARKEMLPLNNTFYGLSCDPFHKQSLKVKDFFESNDYRQMTDRLNFLKDVNGIGVFTAQPGMGKSFALHCFHHSLNANLHQMRYICLSTVSVVEFYKQFCEELGLEAKGGKTSMFKVIQERIFYLFKEKRCPLILAIDEAQYLNEAILKDLKMLMNHQYDSLNCFSLILSGEPRLNFTLEKPMNEALKQRITVHYNFSGLSPDEVTDYIFHKLTLAGGAKTIFSQDALSAVAGFCSGNPRIIDNLVSDALMLGAQLGKQTIDGEVIMAAANAQALG*
Sample Types
Isolate
1.1%
Metagenome
98.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
70.2%
Kalotermitidae
14.9%
Unclassified
8.5%
Termopsidae
6.4%
Taxonomy
Archaea
1
Bacteria
165
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 4 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 5 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 6 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 9 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 10 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 13 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 19 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 20 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 23 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 24 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 34 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 35 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 36 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 37 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 38 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 46 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_485862 | 3300042600 | Bacteria | 1716 |
| 2 | Ga0466717_249052 | 3300042604 | Bacteria | 1673 |
| 3 | Ga0466719_372764 | 3300042606 | Bacteria | 3880 |
| 4 | Ga0466698_313503 | 3300042610 | Bacteria | 1612 |
| 5 | Ga0123356_10032637 | 3300010049 | Bacteria | 4871 |
| 6 | Ga0123356_10196178 | 3300010049 | Bacteria | 2054 |
| 7 | Ga0123356_10622309 | 3300010049 | Bacteria | 1245 |
| 8 | Ga0123353_10490324 | 3300010167 | Bacteria | 1794 |
| 9 | Ga0123353_10525319 | 3300010167 | Bacteria | 1716 |
| 10 | Ga0466710_270577 | 3300042613 | Bacteria | 1872 |
| 11 | Ga0466731_206417 | 3300042622 | Bacteria | 2057 |
| 12 | Ga0466734_114637 | 3300042623 | Bacteria | 1808 |
| 13 | Ga0466734_153235 | 3300042623 | Bacteria | 2013 |
| 14 | Ga0466657_183205 | 3300042582 | Bacteria | 3930 |
| 15 | Ga0466696_281593 | 3300042596 | Bacteria | 1530 |
| 16 | Ga0466699_342395 | 3300042597 | Bacteria | 1722 |
| 17 | JGI24695J34938_10018744 | 3300002450 | Bacteria | 3448 |
| 18 | JGI24702J35022_10021273 | 3300002462 | Bacteria | 3519 |
| 19 | Ga0072940_1011072 | 3300005200 | Bacteria | 7279 |
| 20 | Ga0072940_1184593 | 3300005200 | Bacteria | 3750 |
| 21 | Ga0466697_146349 | 3300042611 | Unclassified | 6836 |
| 22 | Ga0466701_056136 | 3300042598 | Bacteria | 4330 |
| 23 | Ga0466700_242626 | 3300042600 | Bacteria | 3932 |
| 24 | Ga0466707_112469 | 3300042601 | Bacteria | 2598 |
| 25 | Ga0466717_073491 | 3300042604 | Bacteria | 5526 |
| 26 | Ga0466717_237075 | 3300042604 | Bacteria | 3608 |
| 27 | Ga0466698_349061 | 3300042610 | Bacteria | 3668 |
| 28 | Ga0123355_10158474 | 3300009826 | Bacteria | 3417 |
| 29 | Ga0123356_10035442 | 3300010049 | Bacteria | 4662 |
| 30 | Ga0123356_10036435 | 3300010049 | Bacteria | 4594 |
| 31 | Ga0123356_10073210 | 3300010049 | Unclassified | 3221 |
| 32 | Ga0123356_10086041 | 3300010049 | Bacteria | 2983 |
| 33 | Ga0123353_10190182 | 3300010167 | Bacteria | 3241 |
| 34 | Ga0123354_10100118 | 3300010882 | Unclassified | 3926 |
| 35 | Ga0123354_10126215 | 3300010882 | Unclassified | 3266 |
| 36 | Ga0466712_068101 | 3300042614 | Bacteria | 4048 |
| 37 | Ga0466712_106989 | 3300042614 | Bacteria | 1023 |
| 38 | Ga0466731_172353 | 3300042622 | Bacteria | 1912 |
| 39 | Ga0466731_359288 | 3300042622 | Bacteria | 1492 |
| 40 | Ga0466734_053924 | 3300042623 | Bacteria | 3217 |
| 41 | Ga0466735_190244 | 3300042624 | Bacteria | 1811 |
| 42 | Ga0415639_032861 | 3300038395 | Unclassified | 1306 |
| 43 | Ga0415639_032868 | 3300038395 | Bacteria | 1004 |
| 44 | Ga0415639_042032 | 3300038395 | Bacteria | 6183 |
| 45 | Ga0466656_151319 | 3300042550 | Bacteria | 1791 |
| 46 | Ga0466693_365622 | 3300042592 | Bacteria | 3505 |
| 47 | Ga0466694_142093 | 3300042594 | Bacteria | 5200 |
| 48 | Ga0466695_060772 | 3300042595 | Bacteria | 1630 |
| 49 | Ga0466699_424360 | 3300042597 | Bacteria | 5118 |
| 50 | JGI24702J35022_10006911 | 3300002462 | Bacteria | 6529 |
| 51 | JGI24702J35022_10042689 | 3300002462 | Bacteria | 2415 |
| 52 | JGI24702J35022_10045762 | 3300002462 | Bacteria | 2331 |
| 53 | Ga0466701_049061 | 3300042598 | Bacteria | 2729 |
| 54 | Ga0466717_058365 | 3300042604 | Bacteria | 2293 |
| 55 | Ga0466721_384599 | 3300042608 | Bacteria | 1534 |
| 56 | Ga0123357_10210371 | 3300009784 | Bacteria | 2186 |
| 57 | Ga0123355_10403875 | 3300009826 | Bacteria | 1760 |
| 58 | Ga0123356_10097221 | 3300010049 | Bacteria | 2817 |
| 59 | Ga0123356_11198737 | 3300010049 | Bacteria | 925 |
| 60 | Ga0123353_10733780 | 3300010167 | Bacteria | 1379 |
| 61 | Ga0123353_10872236 | 3300010167 | Bacteria | 1230 |
| 62 | Ga0466718_014595 | 3300042617 | Bacteria | 3379 |
| 63 | Ga0466718_028054 | 3300042617 | Bacteria | 2324 |
| 64 | Ga0466726_259392 | 3300042619 | Bacteria | 2846 |
| 65 | Ga0415639_025129 | 3300038395 | Bacteria | 4055 |
| 66 | JGI24695J34938_10016906 | 3300002450 | Bacteria | 3692 |
| 67 | JGI24702J35022_10055037 | 3300002462 | Bacteria | 2122 |
| 68 | JGI24705J35276_12206256 | 3300002504 | Bacteria | 1717 |
| 69 | JGI24705J35276_12216045 | 3300002504 | Unclassified | 2029 |
| 70 | Ga0072940_1300104 | 3300005200 | Bacteria | 1408 |
| 71 | Ga0072941_1150117 | 3300005201 | Bacteria | 4155 |
| 72 | Ga0466697_078222 | 3300042611 | Bacteria | 2797 |
| 73 | Ga0466705_178798 | 3300042612 | Bacteria | 1055 |
| 74 | Ga0466717_182808 | 3300042604 | Bacteria | 2870 |
| 75 | Ga0466721_096339 | 3300042608 | Bacteria | 2530 |
| 76 | Ga0466698_195240 | 3300042610 | Bacteria | 1813 |
| 77 | Ga0123357_10091643 | 3300009784 | Bacteria | 3957 |
| 78 | Ga0123356_10050362 | 3300010049 | Bacteria | 3876 |
| 79 | Ga0123356_10061732 | 3300010049 | Bacteria | 3500 |
| 80 | Ga0123356_10318778 | 3300010049 | Bacteria | 1667 |
| 81 | Ga0123353_10315137 | 3300010167 | Bacteria | 2378 |
| 82 | Ga0123354_10096581 | 3300010882 | Unclassified | 4035 |
| 83 | Ga0466715_143170 | 3300042616 | Bacteria | 3889 |
| 84 | Ga0466731_143526 | 3300042622 | Bacteria | 2046 |
| 85 | Ga0466731_350377 | 3300042622 | Bacteria | 4015 |
| 86 | Ga0466702_102279 | 3300042635 | Bacteria | 10013 |
| 87 | Ga0466725_177174 | 3300042654 | Bacteria | 2204 |
| 88 | Ga0466727_286101 | 3300042655 | Bacteria | 2763 |
| 89 | Ga0466693_178582 | 3300042592 | Bacteria | 1677 |
| 90 | Ga0466693_201234 | 3300042592 | Bacteria | 1749 |
| 91 | Ga0466694_375104 | 3300042594 | Unclassified | 5032 |
| 92 | Ga0466694_404354 | 3300042594 | Bacteria | 2015 |
| 93 | Ga0072941_1497304 | 3300005201 | Bacteria | 3698 |
| 94 | Ga0466701_018836 | 3300042598 | Bacteria | 2421 |
| 95 | Ga0466700_328271 | 3300042600 | Bacteria | 1551 |
| 96 | Ga0466700_336798 | 3300042600 | Bacteria | 2717 |
| 97 | Ga0466717_037202 | 3300042604 | Bacteria | 1908 |
| 98 | Ga0123357_10164716 | 3300009784 | Bacteria | 2644 |
| 99 | Ga0123357_10384880 | 3300009784 | Bacteria | 1297 |
| 100 | Ga0123356_10299591 | 3300010049 | Bacteria | 1712 |
| 101 | Ga0123353_10300788 | 3300010167 | Bacteria | 2449 |
| 102 | Ga0123353_10321064 | 3300010167 | Bacteria | 2350 |
| 103 | Ga0123353_10382076 | 3300010167 | Archaea | 2106 |
| 104 | Ga0123354_10080647 | 3300010882 | Bacteria | 4604 |
| 105 | Ga0123354_10102171 | 3300010882 | Bacteria | 3866 |
| 106 | Ga0466710_291921 | 3300042613 | Bacteria | 1710 |
| 107 | Ga0466728_086003 | 3300042620 | Bacteria | 1417 |
| 108 | Ga0466734_155140 | 3300042623 | Bacteria | 1021 |
| 109 | Ga0415639_118486 | 3300038395 | Bacteria | 3811 |
| 110 | Ga0415639_269365 | 3300038395 | Unclassified | 1080 |
| 111 | Ga0466693_251177 | 3300042592 | Bacteria | 4682 |
| 112 | Ga0466693_447260 | 3300042592 | Bacteria | 2641 |
| 113 | JGI24702J35022_10095729 | 3300002462 | Bacteria | 1620 |
| 114 | Ga0072941_1053878 | 3300005201 | Bacteria | 1669 |
| 115 | Ga0466697_279305 | 3300042611 | Bacteria | 1472 |
| 116 | Ga0466700_379829 | 3300042600 | Bacteria | 4713 |
| 117 | Ga0466707_362955 | 3300042601 | Bacteria | 3645 |
| 118 | Ga0466714_151808 | 3300042603 | Bacteria | 1959 |
| 119 | Ga0466698_084934 | 3300042610 | Bacteria | 1821 |
| 120 | Ga0123356_10647445 | 3300010049 | Bacteria | 1224 |
| 121 | Ga0123353_10100416 | 3300010167 | Bacteria | 4664 |
| 122 | Ga0466728_147883 | 3300042620 | Bacteria | 2897 |
| 123 | Ga0466734_067420 | 3300042623 | Bacteria | 2272 |
| 124 | Ga0466724_54430 | 3300042649 | Bacteria | 4123 |
| 125 | Ga0466708_019840 | 3300042652 | Bacteria | 10358 |
| 126 | Ga0466725_148212 | 3300042654 | Bacteria | 3083 |
| 127 | Ga0415639_004118 | 3300038395 | Unclassified | 3594 |
| 128 | Ga0415639_165569 | 3300038395 | Bacteria | 2447 |
| 129 | Ga0466693_430876 | 3300042592 | Bacteria | 3868 |
| 130 | Ga0466694_179529 | 3300042594 | Bacteria | 1944 |
| 131 | Ga0466696_157906 | 3300042596 | Bacteria | 3962 |
| 132 | Ga0466696_262099 | 3300042596 | Bacteria | 3092 |
| 133 | JGI24695J34938_10020508 | 3300002450 | Unclassified | 3251 |
| 134 | JGI24702J35022_10015409 | 3300002462 | Bacteria | 4207 |
| 135 | JGI24702J35022_10058590 | 3300002462 | Bacteria | 2057 |
| 136 | JGI24703J35330_11508081 | 3300002501 | Bacteria | 1131 |
| 137 | Ga0466733_039059 | 3300042659 | Bacteria | 3203 |
| 138 | Ga0466733_151151 | 3300042659 | Bacteria | 3182 |
| 139 | Ga0466701_020741 | 3300042598 | Bacteria | 3635 |
| 140 | Ga0123355_10101285 | 3300009826 | Bacteria | 4534 |
| 141 | Ga0123355_10102843 | 3300009826 | Unclassified | 4491 |
| 142 | Ga0123356_10262235 | 3300010049 | Bacteria | 1812 |
| 143 | Ga0466710_209896 | 3300042613 | Bacteria | 3841 |
| 144 | Ga0466718_030956 | 3300042617 | Bacteria | 2843 |
| 145 | Ga0466723_167936 | 3300042618 | Bacteria | 1067 |
| 146 | Ga0466731_076690 | 3300042622 | Bacteria | 1740 |
| 147 | Ga0466731_135581 | 3300042622 | Bacteria | 2338 |
| 148 | Ga0466731_264141 | 3300042622 | Bacteria | 2017 |
| 149 | Ga0466734_018501 | 3300042623 | Bacteria | 3395 |
| 150 | Ga0466702_434700 | 3300042635 | Bacteria | 1119 |
| 151 | Ga0415639_198948 | 3300038395 | Bacteria | 3071 |
| 152 | Ga0466693_360108 | 3300042592 | Bacteria | 3657 |
| 153 | Ga0466694_026802 | 3300042594 | Bacteria | 4037 |
| 154 | JGI24695J34938_10014474 | 3300002450 | Unclassified | 4087 |
| 155 | JGI24702J35022_10020447 | 3300002462 | Bacteria | 3594 |
| 156 | Ga0068305_10028782 | 3300005083 | Bacteria | 3432 |
| 157 | Ga0072941_1420985 | 3300005201 | Bacteria | 942 |
| 158 | Ga0466701_070015 | 3300042598 | Unclassified | 5480 |
| 159 | Ga0466700_254381 | 3300042600 | Bacteria | 1029 |
| 160 | Ga0466717_175266 | 3300042604 | Bacteria | 2474 |
| 161 | Ga0466717_226135 | 3300042604 | Bacteria | 3221 |
| 162 | Ga0466717_302793 | 3300042604 | Bacteria | 2775 |
| 163 | Ga0466698_427844 | 3300042610 | Bacteria | 2175 |
| 164 | Ga0123357_10089053 | 3300009784 | Bacteria | 4031 |
| 165 | Ga0123355_10076300 | 3300009826 | Bacteria | 5361 |
| 166 | Ga0123356_10027477 | 3300010049 | Bacteria | 5332 |
| 167 | Ga0123356_10044939 | 3300010049 | Bacteria | 4110 |
| 168 | Ga0123356_10109794 | 3300010049 | Bacteria | 2662 |
| 169 | Ga0123356_10171614 | 3300010049 | Unclassified | 2180 |
| 170 | Ga0123353_10115084 | 3300010167 | Bacteria | 4329 |
| 171 | Ga0123353_10129501 | 3300010167 | Bacteria | 4052 |
| 172 | Ga0123353_10717306 | 3300010167 | Bacteria | 1400 |
| 173 | Ga0466731_027180 | 3300042622 | Bacteria | 2220 |
| 174 | Ga0466731_075584 | 3300042622 | Bacteria | 1204 |
| 175 | Ga0466731_091362 | 3300042622 | Unclassified | 2066 |
| 176 | Ga0466731_364751 | 3300042622 | Bacteria | 1777 |
| 177 | Ga0466734_044355 | 3300042623 | Bacteria | 3153 |
| 178 | Ga0466702_221494 | 3300042635 | Bacteria | 3674 |
| 179 | Ga0466656_184857 | 3300042550 | Bacteria | 3689 |
| 180 | Ga0466694_260505 | 3300042594 | Bacteria | 5653 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13401 | AAA_22 | AAA domain | 51 | 177 | 0.91 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF13401 | GO:0016887 | ATP hydrolysis activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.