Protein Family IF03123
Metagenome
Isolate
121
Members
56
Samples
107
Scaffolds
286.34
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10089420|Ga0123353_100894204
- Length
- 326 aa
- Sequence
- MSKGLEDKPEINPAGDSISRLAALRNESVVMPDIYPAKAPAGHLTRRRRRYRVNRPFAGLLFLAPGFIGFCVFYIWPFFVSLWYSLLSRPVNGVFVGVKNYAEMFQNIAYLKGLTNTARFIGISVPLSMAHMIRGLLRNREFFTLIFLIPLVIPTGSTVTFWRVLLARDGALNGILHSFGIERLNWLDSGLTFWVIVAIFTWKSLGFNIVLFISGLGNIPAEYYEAAWVDGARPGQVFLKITLPHLGATSVLVLILSIVNSFKVFKEIYLITGSYPHESIYTLQHFMNNMFASLNYPKLTTATSILVAMIALLTQALLRLERRAA*
Sample Types
Isolate
11.6%
Metagenome
88.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.6%
Unclassified
27.8%
Kalotermitidae
16.7%
Rhinotermitidae
5.6%
Termopsidae
5.6%
Passalidae
1.9%
Taxonomy
Archaea
0
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 2 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 3 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 4 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 5 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 2820426531 | Unclassified Firmicutes Lab288P3bin45 | Isolate | Unclassified |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 16 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 17 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 23 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 24 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 34 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 38 | 2820369699 | Unclassified Firmicutes Nt197P3bin103 | Isolate | Unclassified |
| 39 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 44 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 45 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 46 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 47 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 48 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 49 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 50 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 51 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 52 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 53 | 2820323050 | Unclassified Firmicutes Nt197P3bin84 | Isolate | Unclassified |
| 54 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 56 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_229041 | 3300042612 | Bacteria | 3480 |
| 2 | Ga0466733_067668 | 3300042659 | Bacteria | 13618 |
| 3 | Ga0466712_137959 | 3300042614 | Bacteria | 23695 |
| 4 | Ga0466712_192768 | 3300042614 | Bacteria | 48341 |
| 5 | Ga0466718_169320 | 3300042617 | Bacteria | 3255 |
| 6 | Ga0123353_10156079 | 3300010167 | Bacteria | 3638 |
| 7 | Ga0123353_10197821 | 3300010167 | Bacteria | 3166 |
| 8 | JGI24698J34947_10006826 | 3300002449 | Unclassified | 6271 |
| 9 | JGI24695J34938_10000081 | 3300002450 | Bacteria | 82371 |
| 10 | JGI24695J34938_10000297 | 3300002450 | Bacteria | 49030 |
| 11 | JGI24695J34938_10019343 | 3300002450 | Bacteria | 3378 |
| 12 | JGI24705J35276_12126899 | 3300002504 | Unclassified | 1091 |
| 13 | Ga0466707_128735 | 3300042601 | Bacteria | 2924 |
| 14 | Ga0466720_167592 | 3300042607 | Bacteria | 2684 |
| 15 | Ga0466722_106418 | 3300042609 | Bacteria | 1548 |
| 16 | Ga0415639_045531 | 3300038395 | Bacteria | 1216 |
| 17 | Ga0466694_012065 | 3300042594 | Bacteria | 1899 |
| 18 | Ga0466709_374121 | 3300042648 | Bacteria | 5213 |
| 19 | Ga0466718_057329 | 3300042617 | Bacteria | 3979 |
| 20 | Ga0466723_229597 | 3300042618 | Bacteria | 17344 |
| 21 | Ga0123355_10020149 | 3300009826 | Bacteria | 10639 |
| 22 | JGI24698J34947_10009128 | 3300002449 | Unclassified | 5443 |
| 23 | Ga0466716_090573 | 3300042605 | Bacteria | 3047 |
| 24 | Ga0466722_197463 | 3300042609 | Bacteria | 9020 |
| 25 | Ga0466722_257521 | 3300042609 | Bacteria | 4888 |
| 26 | Ga0466694_139560 | 3300042594 | Bacteria | 4797 |
| 27 | Ga0466708_449114 | 3300042652 | Bacteria | 1161 |
| 28 | Ga0466727_082094 | 3300042655 | Bacteria | 2207 |
| 29 | Ga0466697_077200 | 3300042611 | Bacteria | 3879 |
| 30 | Ga0466710_056001 | 3300042613 | Bacteria | 3481 |
| 31 | Ga0466712_277678 | 3300042614 | Bacteria | 2375 |
| 32 | Ga0123355_10000589 | 3300009826 | Bacteria | 48988 |
| 33 | Ga0123356_10016262 | 3300010049 | Bacteria | 7105 |
| 34 | Ga0123353_10360159 | 3300010167 | Bacteria | 2186 |
| 35 | Ga0123353_10802509 | 3300010167 | Bacteria | 1299 |
| 36 | JGI24698J34947_10001077 | 3300002449 | Unclassified | 14051 |
| 37 | JGI24698J34947_10004306 | 3300002449 | Bacteria | 7748 |
| 38 | Ga0466701_038497 | 3300042598 | Bacteria | 1072 |
| 39 | Ga0466722_167846 | 3300042609 | Bacteria | 5329 |
| 40 | Ga0264413_135146 | 3300024493 | Bacteria | 3573 |
| 41 | Ga0466692_147873 | 3300042591 | Bacteria | 8969 |
| 42 | Ga0466733_134185 | 3300042659 | Bacteria | 1718 |
| 43 | Ga0466712_068154 | 3300042614 | Bacteria | 1664 |
| 44 | Ga0466712_157663 | 3300042614 | Bacteria | 1537 |
| 45 | Ga0466726_099832 | 3300042619 | Bacteria | 2597 |
| 46 | Ga0466726_463543 | 3300042619 | Bacteria | 6344 |
| 47 | Ga0123353_10308222 | 3300010167 | Bacteria | 2411 |
| 48 | JGI24702J35022_10103827 | 3300002462 | Bacteria | 1558 |
| 49 | JGI24705J35276_12238201 | 3300002504 | Bacteria | 17219 |
| 50 | Ga0466707_387069 | 3300042601 | Bacteria | 86246 |
| 51 | Ga0466690_106857 | 3300042590 | Bacteria | 1751 |
| 52 | Ga0466699_329555 | 3300042597 | Bacteria | 14178 |
| 53 | Ga0466735_104168 | 3300042624 | Bacteria | 1238 |
| 54 | Ga0466727_241947 | 3300042655 | Bacteria | 1988 |
| 55 | Ga0466712_045152 | 3300042614 | Bacteria | 8347 |
| 56 | Ga0466712_299993 | 3300042614 | Bacteria | 1700 |
| 57 | Ga0466715_399197 | 3300042616 | Bacteria | 27844 |
| 58 | Ga0466718_048501 | 3300042617 | Bacteria | 2220 |
| 59 | Ga0466726_133676 | 3300042619 | Bacteria | 28110 |
| 60 | Ga0123355_10051443 | 3300009826 | Bacteria | 6685 |
| 61 | Ga0123353_10115336 | 3300010167 | Bacteria | 4323 |
| 62 | JGI24698J34947_10001426 | 3300002449 | Bacteria | 12579 |
| 63 | JGI24698J34947_10026950 | 3300002449 | Bacteria | 3050 |
| 64 | Ga0072941_1019844 | 3300005201 | Bacteria | 13686 |
| 65 | Ga0466700_262554 | 3300042600 | Bacteria | 5040 |
| 66 | Ga0123355_10458156 | 3300009826 | Bacteria | 1602 |
| 67 | AustNasuHG_c1003109 | 3300000089 | Unclassified | 5989 |
| 68 | JGI24698J34947_10000541 | 3300002449 | Bacteria | 17921 |
| 69 | JGI24702J35022_10023367 | 3300002462 | Bacteria | 3343 |
| 70 | Ga0466717_294810 | 3300042604 | Bacteria | 9955 |
| 71 | Ga0466717_313968 | 3300042604 | Bacteria | 1467 |
| 72 | Ga0466694_174639 | 3300042594 | Bacteria | 7958 |
| 73 | Ga0466694_374737 | 3300042594 | Bacteria | 3560 |
| 74 | Ga0466708_072396 | 3300042652 | Bacteria | 9022 |
| 75 | Ga0466712_066723 | 3300042614 | Bacteria | 8594 |
| 76 | Ga0466712_099886 | 3300042614 | Bacteria | 1798 |
| 77 | Ga0466726_445217 | 3300042619 | Bacteria | 6114 |
| 78 | Ga0466728_116894 | 3300042620 | Bacteria | 7521 |
| 79 | Ga0466729_173878 | 3300042621 | Bacteria | 7650 |
| 80 | Ga0123353_10200720 | 3300010167 | Bacteria | 3138 |
| 81 | JGI24698J34947_10071234 | 3300002449 | Bacteria | 1669 |
| 82 | JGI24695J34938_10000274 | 3300002450 | Bacteria | 50501 |
| 83 | JGI24695J34938_10003744 | 3300002450 | Bacteria | 10394 |
| 84 | JGI24695J34938_10006357 | 3300002450 | Bacteria | 7129 |
| 85 | Ga0123357_10001297 | 3300009784 | Bacteria | 26360 |
| 86 | Ga0466700_263224 | 3300042600 | Bacteria | 4147 |
| 87 | Ga0466707_282260 | 3300042601 | Bacteria | 1829 |
| 88 | Ga0466714_114529 | 3300042603 | Bacteria | 4649 |
| 89 | Ga0466717_070109 | 3300042604 | Bacteria | 1247 |
| 90 | Ga0466717_106960 | 3300042604 | Unclassified | 1632 |
| 91 | Ga0466720_121143 | 3300042607 | Bacteria | 9378 |
| 92 | Ga0466699_429337 | 3300042597 | Bacteria | 7244 |
| 93 | Ga0466725_179476 | 3300042654 | Bacteria | 1867 |
| 94 | Ga0466697_072812 | 3300042611 | Bacteria | 3345 |
| 95 | Ga0466712_053246 | 3300042614 | Unclassified | 19916 |
| 96 | Ga0466712_086762 | 3300042614 | Bacteria | 4035 |
| 97 | Ga0466718_089527 | 3300042617 | Bacteria | 1209 |
| 98 | Ga0123355_10250409 | 3300009826 | Bacteria | 2495 |
| 99 | Ga0123356_10058220 | 3300010049 | Bacteria | 3602 |
| 100 | Ga0123353_10006834 | 3300010167 | Bacteria | 15309 |
| 101 | Ga0123353_10089420 | 3300010167 | Bacteria | 4959 |
| 102 | IMNBL1DRAFT_c0000795 | 3300000062 | Bacteria | 24889 |
| 103 | AustNasuHG_c1001709 | 3300000089 | Bacteria | 7928 |
| 104 | Ga0466720_094458 | 3300042607 | Bacteria | 5429 |
| 105 | Ga0466694_102175 | 3300042594 | Bacteria | 1902 |
| 106 | Ga0466699_403437 | 3300042597 | Bacteria | 1634 |
| 107 | Ga0466704_035573 | 3300042643 | Bacteria | 9570 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 144 | 315 | 0.71 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.