Protein Family IF03104

Metagenome Isolate
127 Members
53 Samples
109 Scaffolds
393.28 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10061555|Ga0123353_100615552
Length
464 aa
Sequence
MMTKTVEQGELGMEYMTVREASVKWGVTVRQVQYGCEKGHVENAIRTGHMWLIHKDAPKPADGRTKAAKQRKGLIQDGGYDPMGDRYELRLYDIKMLSFTLTSDPALGYMTEINEISDLDKLLPLDLELNGDGILRWLERRVIPKNRTFVEEILRSFGLVLGDTKGIIDICKGLSLNDSYWIVPVGFDGKFADYNLYENRFSEILSLVAYTGITQSDAAFSTSPELTTDGMLPKAWRFIDGEGIFLYKGGISGFANSGKEPYCEFYASQIAAAMNLDAVLYELENWKGILASKCKLFTDIDTSFIPIGRVVKSGGLAAVMSYYDELGGIFADAIRDMLVFDALTYNEDRHFGNFGLLRDNHTGEIKAPAPIFDNGVSLFSYAMKDDYANLDNYAKTRSPVYPGTTFEGICQTFMTARQVEKLRKMVKFTFKRHPKLNLPEEHVAAIEKHIQKRASQLIGLPRR*

📊 Sample Types

Isolate 14.2%
Metagenome 85.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.7%
Unclassified 32.1%
Kalotermitidae 18.9%
Rhinotermitidae 5.7%
Termopsidae 3.8%
Passalidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 123
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
2 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
3 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
4 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
5 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
6 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
7 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
8 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
14 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
15 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
18 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
19 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
20 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
21 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
22 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
23 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
24 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
25 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
26 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
27 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
28 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
29 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
30 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
33 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
34 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
37 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
38 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
39 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
44 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
45 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
46 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
47 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
48 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
49 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
50 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
51 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
52 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
53 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_222802 3300042612 Bacteria 2173
2 Ga0415639_009655 3300038395 Bacteria 35052
3 Ga0466693_005933 3300042592 Bacteria 3916
4 JGI24695J34938_10000065 3300002450 Bacteria 87483
5 JGI24695J34938_10017020 3300002450 Bacteria 3676
6 Ga0123355_10000603 3300009826 Bacteria 48510
7 Ga0123355_10035540 3300009826 Unclassified 8098
8 Ga0466729_283291 3300042621 Bacteria 3304
9 Ga0466703_118091 3300042636 Bacteria 1826
10 Ga0466704_203613 3300042643 Bacteria 26975
11 Ga0466705_442404 3300042612 Bacteria 1746
12 Ga0466721_020084 3300042608 Bacteria 10818
13 JGI24702J35022_10011550 3300002462 Bacteria 4920
14 Ga0123357_10089527 3300009784 Bacteria 4018
15 Ga0123355_10151467 3300009826 Bacteria 3522
16 Ga0123355_10246656 3300009826 Bacteria 2521
17 Ga0123355_10264874 3300009826 Bacteria 2398
18 Ga0123356_10024523 3300010049 Bacteria 5674
19 Ga0123356_10264991 3300010049 Bacteria 1804
20 Ga0466729_307062 3300042621 Bacteria 4361
21 Ga0466703_368401 3300042636 Bacteria 4788
22 Ga0466704_486762 3300042643 Bacteria 12479
23 Ga0466711_464231 3300042615 Bacteria 3239
24 Ga0466714_133225 3300042603 Unclassified 4190
25 Ga0466705_083834 3300042612 Bacteria 4199
26 Ga0415639_080625 3300038395 Bacteria 4913
27 Ga0466692_018900 3300042591 Bacteria 11807
28 Ga0466694_112993 3300042594 Bacteria 2655
29 Ga0466694_239160 3300042594 Bacteria 6425
30 Ga0123355_10298738 3300009826 Bacteria 2198
31 Ga0123356_10073569 3300010049 Bacteria 3214
32 Ga0123356_10097250 3300010049 Bacteria 2816
33 Ga0123353_10053982 3300010167 Bacteria 6423
34 Ga0123353_10447932 3300010167 Bacteria 1902
35 Ga0123354_10267445 3300010882 Unclassified 1691
36 Ga0466704_379993 3300042643 Bacteria 2739
37 Ga0466715_139565 3300042616 Bacteria 5442
38 Ga0466700_232120 3300042600 Bacteria 1607
39 Ga0466714_034053 3300042603 Bacteria 8647
40 Ga0466694_322829 3300042594 Bacteria 3444
41 Ga0123355_10456496 3300009826 Bacteria 1607
42 Ga0123353_10061555 3300010167 Unclassified 6019
43 Ga0123353_10217915 3300010167 Bacteria 2988
44 Ga0123353_10275777 3300010167 Bacteria 2587
45 Ga0466731_310391 3300042622 Bacteria 1380
46 Ga0466704_039291 3300042643 Bacteria 12127
47 Ga0466711_235574 3300042615 Bacteria 2795
48 Ga0466726_260922 3300042619 Bacteria 8830
49 Ga0466714_042231 3300042603 Bacteria 9672
50 Ga0466719_059086 3300042606 Bacteria 3577
51 Ga0466705_276527 3300042612 Bacteria 7672
52 IMNBL1DRAFT_c0002569 3300000062 Bacteria 12506
53 JGI24702J35022_10000851 3300002462 Bacteria 18865
54 JGI24703J35330_11748633 3300002501 Bacteria 22874
55 Ga0123355_10000053 3300009826 Bacteria 119276
56 Ga0123355_10083554 3300009826 Bacteria 5090
57 Ga0123356_10000142 3300010049 Bacteria 81248
58 Ga0123356_10025952 3300010049 Bacteria 5508
59 Ga0123356_10092647 3300010049 Bacteria 2882
60 Ga0123356_10170402 3300010049 Bacteria 2187
61 Ga0123356_10233300 3300010049 Bacteria 1906
62 Ga0123353_10165557 3300010167 Bacteria 3515
63 Ga0123353_10377712 3300010167 Bacteria 2121
64 Ga0123353_10450721 3300010167 Bacteria 1894
65 Ga0123353_10664457 3300010167 Bacteria 1472
66 Ga0466704_176444 3300042643 Bacteria 7051
67 Ga0466704_363955 3300042643 Bacteria 7323
68 Ga0466726_128286 3300042619 Bacteria 20239
69 Ga0466726_204764 3300042619 Bacteria 11057
70 Ga0466705_201431 3300042612 Bacteria 4841
71 Ga0415639_003993 3300038395 Bacteria 39828
72 Ga0415639_011993 3300038395 Bacteria 11924
73 Ga0466696_371412 3300042596 Bacteria 1614
74 Ga0466696_408839 3300042596 Bacteria 3525
75 Ga0466696_486639 3300042596 Bacteria 1446
76 Ga0123353_10011377 3300010167 Bacteria 12531
77 Ga0123353_10083539 3300010167 Bacteria 5139
78 Ga0123353_10608835 3300010167 Bacteria 1559
79 Ga0466704_213268 3300042643 Bacteria 1969
80 Ga0466725_438245 3300042654 Bacteria 1863
81 Ga0466723_058163 3300042618 Bacteria 2654
82 Ga0466714_051721 3300042603 Bacteria 1280
83 Ga0466705_067183 3300042612 Bacteria 2424
84 Ga0466705_382576 3300042612 Bacteria 40211
85 Ga0466733_202019 3300042659 Bacteria 3305
86 Ga0466690_261744 3300042590 Bacteria 3103
87 Ga0466691_148224 3300042593 Bacteria 9593
88 JGI24703J35330_11729753 3300002501 Bacteria 2674
89 Ga0072940_1190965 3300005200 Bacteria 2464
90 Ga0123356_10212782 3300010049 Bacteria 1983
91 Ga0123353_10247630 3300010167 Bacteria 2763
92 Ga0466731_298124 3300042622 Bacteria 2709
93 Ga0466735_140512 3300042624 Bacteria 2395
94 Ga0466704_449076 3300042643 Bacteria 2161
95 Ga0466705_381432 3300042612 Bacteria 1665
96 Ga0466696_479869 3300042596 Bacteria 1921
97 Ga0466699_191291 3300042597 Bacteria 2227
98 AustNasuHG_c1012333 3300000089 Bacteria 2950
99 JGI24702J35022_10024940 3300002462 Bacteria 3228
100 Ga0123355_10114300 3300009826 Bacteria 4208
101 Ga0123355_10145916 3300009826 Bacteria 3608
102 Ga0123355_10513937 3300009826 Bacteria 1470
103 Ga0123356_10026364 3300010049 Bacteria 5457
104 Ga0123356_10089472 3300010049 Bacteria 2929
105 Ga0123353_10022331 3300010167 Bacteria 9536
106 Ga0466704_199724 3300042643 Bacteria 5182
107 Ga0466704_483989 3300042643 Bacteria 3777
108 Ga0466726_357350 3300042619 Bacteria 15338
109 Ga0466722_019557 3300042609 Bacteria 12022

🧩 MSA Aligner

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.