Protein Family IF03102

Metagenome Isolate
126 Members
58 Samples
115 Scaffolds
458 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10057420|Ga0123353_100574203
Length
492 aa
Sequence
MFPRSFRAGEFLFLSKLFRTFGLIKKPFMFTKDIYVQRRKALCAQLQSGLLLFLGNKEAPYNYLDNTYRFRQDSSFLYFFGLDEANLAVTIDLETGAETLFGDDIGIDSIVWMGPKPSMREKADRVGIAHVRPMADLANTVKKAAASGRMVHYLPPYRYANKITLMDLLGIHPNEQKANASEAFIRAVVALRAVKQPEEVVELDKAANIGYMMHYTAMKMAKLGMLEQELVGVMEGIAVSNGTMPSFPIILSQNGETLHNHSHHQILTDGRLLLIDAGAETNSHYASDFTRTIPSGGKFTQQQKELYNLVLEATDHAISLCKPEVPFKEVYFAASRIITEGLKGMGIMKGNTDDAIANGAHAMFFPCGLGHNMGMDVHDMEDLGENFVGYDDTVTRSTQFGLKSLRMAKALKVGNVMTVEPGIYFIPALMDKWRAEKVNTDFLCFDEMDKFRSFGGIRIEECIIITQNGYRMLGSKRLPVTVEEIEGVMQE*

📊 Sample Types

Isolate 8.7%
Metagenome 91.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.6%
Kalotermitidae 24.6%
Unclassified 22.8%
Termopsidae 5.3%
Rhinotermitidae 3.5%
Passalidae 3.5%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 119
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
2 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
7 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
15 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
18 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
19 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
20 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
21 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
27 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
28 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
29 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
30 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
31 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
32 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
33 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
34 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
35 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
36 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
37 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
38 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
39 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
40 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
41 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
46 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
47 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
48 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
49 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
50 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
51 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
52 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
53 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
54 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
55 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
56 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
57 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
58 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10458894 3300010167 Bacteria 1873
2 Ga0466694_251036 3300042594 Bacteria 2666
3 Ga0466701_042840 3300042598 Bacteria 60722
4 Ga0466700_172636 3300042600 Bacteria 2535
5 JGI24696J40584_12937490 3300002834 Bacteria 1604
6 Ga0466710_225212 3300042613 Bacteria 4583
7 Ga0466711_248141 3300042615 Bacteria 4770
8 Ga0466715_038006 3300042616 Unclassified 6395
9 Ga0466728_482084 3300042620 Bacteria 5250
10 Ga0466732_143597 3300042656 Bacteria 3179
11 Ga0123356_10010660 3300010049 Bacteria 8998
12 Ga0123353_10000524 3300010167 Bacteria 47418
13 Ga0123353_10009879 3300010167 Bacteria 13232
14 Ga0123354_10309438 3300010882 Bacteria 1478
15 Ga0466704_475354 3300042643 Bacteria 6516
16 Ga0466708_101521 3300042652 Bacteria 25266
17 Ga0466692_029952 3300042591 Bacteria 12294
18 Ga0466691_128298 3300042593 Bacteria 15773
19 Ga0466694_098013 3300042594 Bacteria 1752
20 Ga0466696_172325 3300042596 Bacteria 37657
21 Ga0466701_022200 3300042598 Bacteria 40475
22 Ga0466713_065185 3300042602 Bacteria 22604
23 Ga0466717_200839 3300042604 Bacteria 2945
24 Ga0466722_239795 3300042609 Bacteria 3282
25 JGI24702J35022_10021767 3300002462 Bacteria 3475
26 Ga0466710_335384 3300042613 Bacteria 2817
27 Ga0466715_540931 3300042616 Bacteria 8372
28 Ga0466723_162835 3300042618 Bacteria 17681
29 Ga0123353_10197041 3300010167 Bacteria 3174
30 Ga0466709_366043 3300042648 Bacteria 20315
31 Ga0466708_061894 3300042652 Bacteria 6493
32 Ga0466657_165999 3300042582 Bacteria 18662
33 Ga0466696_438532 3300042596 Bacteria 3976
34 Ga0466714_053209 3300042603 Bacteria 3207
35 IMNBL1DRAFT_c0000765 3300000062 Bacteria 25410
36 Ga0072941_1294424 3300005201 Unclassified 1556
37 Ga0466710_006597 3300042613 Bacteria 6458
38 Ga0466697_150127 3300042611 Bacteria 16959
39 Ga0466705_153953 3300042612 Bacteria 6439
40 Ga0123353_10014439 3300010167 Bacteria 11388
41 Ga0123353_10057420 3300010167 Bacteria 6235
42 Ga0123353_10307927 3300010167 Bacteria 2413
43 Ga0123353_10496388 3300010167 Bacteria 1780
44 Ga0466731_370950 3300042622 Bacteria 29682
45 Ga0466704_613633 3300042643 Bacteria 4805
46 Ga0466727_148661 3300042655 Unclassified 3361
47 Ga0415639_227524 3300038395 Bacteria 1470
48 Ga0466691_186282 3300042593 Bacteria 110439
49 Ga0466707_117862 3300042601 Bacteria 6114
50 Ga0466714_082032 3300042603 Bacteria 1623
51 Ga0466720_006336 3300042607 Bacteria 1574
52 2227303003 2225789004 Bacteria 29568
53 IMNBL1DRAFT_c0019456 3300000062 Bacteria 2780
54 JGI24695J34938_10000921 3300002450 Bacteria 26914
55 JGI24702J35022_10001486 3300002462 Bacteria 14546
56 JGI24702J35022_10036711 3300002462 Bacteria 2618
57 JGI24696J40584_12959681 3300002834 Bacteria 5463
58 Ga0466710_410830 3300042613 Bacteria 2445
59 Ga0466710_416632 3300042613 Bacteria 5108
60 Ga0466726_216938 3300042619 Bacteria 10941
61 Ga0466732_031869 3300042656 Bacteria 1543
62 Ga0123356_10156757 3300010049 Bacteria 2268
63 Ga0466709_404772 3300042648 Bacteria 4773
64 Ga0466724_04033 3300042649 Unclassified 11133
65 Ga0466724_44043 3300042649 Bacteria 4452
66 Ga0466697_002003 3300042611 Bacteria 5456
67 JGI24702J35022_10005031 3300002462 Bacteria 7786
68 JGI24696J40584_12938849 3300002834 Bacteria 1637
69 Ga0466723_140932 3300042618 Bacteria 4934
70 Ga0123356_10193843 3300010049 Bacteria 2065
71 Ga0123353_10001245 3300010167 Bacteria 31217
72 Ga0123353_10001720 3300010167 Bacteria 26897
73 Ga0123353_10003643 3300010167 Unclassified 19535
74 Ga0123354_10101108 3300010882 Bacteria 3896
75 Ga0466731_148646 3300042622 Bacteria 6425
76 Ga0466731_294254 3300042622 Unclassified 2799
77 Ga0466731_350611 3300042622 Bacteria 5536
78 Ga0466704_035521 3300042643 Bacteria 2779
79 Ga0466709_404640 3300042648 Bacteria 6899
80 Ga0466708_069911 3300042652 Bacteria 13157
81 Ga0466690_289464 3300042590 Bacteria 5737
82 Ga0466693_267952 3300042592 Bacteria 2302
83 Ga0466691_032786 3300042593 Bacteria 7446
84 Ga0466694_180729 3300042594 Bacteria 27161
85 Ga0466716_014100 3300042605 Bacteria 4922
86 JGI24705J35276_12211111 3300002504 Bacteria 1846
87 Ga0466710_423418 3300042613 Bacteria 2419
88 Ga0466715_458370 3300042616 Bacteria 11761
89 Ga0466728_328142 3300042620 Bacteria 14016
90 Ga0466732_058962 3300042656 Bacteria 3957
91 Ga0123356_10052479 3300010049 Bacteria 3793
92 Ga0123353_10135962 3300010167 Bacteria 3942
93 Ga0466735_036541 3300042624 Bacteria 1466
94 Ga0466704_051910 3300042643 Bacteria 10915
95 Ga0466708_247588 3300042652 Bacteria 14400
96 Ga0466727_042687 3300042655 Bacteria 90775
97 Ga0466690_265413 3300042590 Unclassified 5612
98 Ga0466701_080615 3300042598 Bacteria 5380
99 Ga0466706_111816 3300042599 Bacteria 19512
100 Ga0466713_004830 3300042602 Bacteria 17469
101 Ga0466698_457661 3300042610 Bacteria 4622
102 JGI24702J35022_10024026 3300002462 Bacteria 3294
103 Ga0466710_344683 3300042613 Bacteria 2061
104 Ga0466711_317316 3300042615 Bacteria 3488
105 Ga0466715_565722 3300042616 Bacteria 2762
106 Ga0466726_139474 3300042619 Bacteria 4387
107 Ga0466705_085012 3300042612 Bacteria 5557
108 Ga0466703_412985 3300042636 Bacteria 6408
109 Ga0466691_127674 3300042593 Bacteria 11737
110 Ga0466706_104368 3300042599 Bacteria 11562
111 Ga0466713_088794 3300042602 Bacteria 20552
112 Ga0466719_283993 3300042606 Bacteria 3749
113 2227080791 2225789004 Bacteria 41979
114 JGI24702J35022_10000043 3300002462 Bacteria 52570
115 Ga0466723_326527 3300042618 Bacteria 8684

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_248141 Ga0466711_248141_84_1295 394
2 3300042594 Ga0466694_098013 Ga0466694_098013_499_1689 396
3 3300042624 Ga0466735_036541 Ga0466735_036541_13_1239 408
4 3300042611 Ga0466697_002003 Ga0466697_002003_364_1740 425
5 3300010167 Ga0123353_10001245 Ga0123353_1000124520 428
6 3300042649 Ga0466724_44043 Ga0466724_44043_1568_2944 430
7 3300042622 Ga0466731_370950 Ga0466731_370950_19288_20664 434
8 3300002462 JGI24702J35022_10000043 JGI24702J35022_1000004346 437
9 3300010049 Ga0123356_10052479 Ga0123356_100524792 437
10 3300010167 Ga0123353_10014439 Ga0123353_100144397 439
11 3300038395 Ga0415639_227524 Ga0415639_227524_57_1376 439
12 3300042598 Ga0466701_022200 Ga0466701_022200_34291_35667 439
13 3300042613 Ga0466710_423418 Ga0466710_423418_795_2171 440
14 3300042610 Ga0466698_457661 Ga0466698_457661_1670_3046 443
15 3300042600 Ga0466700_172636 Ga0466700_172636_269_1642 444
16 3300010882 Ga0123354_10309438 Ga0123354_103094382 445
17 3300042593 Ga0466691_128298 Ga0466691_128298_8416_9753 445
18 3300042622 Ga0466731_350611 Ga0466731_350611_3750_5126 445
19 3300042613 Ga0466710_225212 Ga0466710_225212_273_1646 446
20 3300010167 Ga0123353_10307927 Ga0123353_103079272 449
21 3300042656 Ga0466732_058962 Ga0466732_058962_1783_3174 453
22 3300042613 Ga0466710_410830 Ga0466710_410830_741_2111 456
23 3300010167 Ga0123353_10003643 Ga0123353_1000364314 457
24 3300042582 Ga0466657_165999 Ga0466657_165999_15771_17144 457
25 3300042598 Ga0466701_042840 Ga0466701_042840_51148_52521 457
26 3300042649 Ga0466724_04033 Ga0466724_04033_3926_5299 457
27 3300042594 Ga0466694_251036 Ga0466694_251036_1117_2493 458
28 3300042601 Ga0466707_117862 Ga0466707_117862_1280_2656 458
29 3300042607 Ga0466720_006336 Ga0466720_006336_30_1406 458
30 3300042613 Ga0466710_006597 Ga0466710_006597_50_1426 458
31 3300042613 Ga0466710_335384 Ga0466710_335384_924_2300 458
32 3300042616 Ga0466715_038006 Ga0466715_038006_814_2190 458
33 3300042622 Ga0466731_148646 Ga0466731_148646_4133_5509 458
34 3300042622 Ga0466731_294254 Ga0466731_294254_10_1386 458
35 3300042656 Ga0466732_143597 Ga0466732_143597_1609_2985 458
36 iso_pr_bacteria 2820753519 2820755276 458
37 iso_pr_bacteria 2820755292 2820755629 458
38 iso_pr_bacteria 2820783511 2820785439 458
39 iso_pr_bacteria 2820792843 2820794977 458
40 iso_pr_bacteria 2820795054 2820795378 458
41 iso_pr_bacteria 2820797595 2820797716 458
42 3300002450 JGI24695J34938_10000921 JGI24695J34938_100009218 459
43 3300002462 JGI24702J35022_10024026 JGI24702J35022_100240263 459
44 3300002834 JGI24696J40584_12937490 JGI24696J40584_129374902 459
45 3300002834 JGI24696J40584_12959681 JGI24696J40584_129596811 459
46 3300005201 Ga0072941_1294424 Ga0072941_12944241 459
47 3300010049 Ga0123356_10010660 Ga0123356_100106605 459
48 3300010049 Ga0123356_10193843 Ga0123356_101938432 459
49 3300010167 Ga0123353_10000524 Ga0123353_1000052410 459
50 3300010167 Ga0123353_10009879 Ga0123353_1000987912 459
51 3300010167 Ga0123353_10135962 Ga0123353_101359624 459
52 3300010167 Ga0123353_10197041 Ga0123353_101970412 459
53 3300010882 Ga0123354_10101108 Ga0123354_101011083 459
54 2225789004 2227303003 2227752998 460
55 3300042592 Ga0466693_267952 Ga0466693_267952_689_2074 461
56 3300042596 Ga0466696_438532 Ga0466696_438532_1323_2708 461
57 3300042598 Ga0466701_080615 Ga0466701_080615_135_1520 461
58 3300042602 Ga0466713_088794 Ga0466713_088794_8369_9754 461
59 3300042613 Ga0466710_344683 Ga0466710_344683_229_1614 461
60 3300042619 Ga0466726_139474 Ga0466726_139474_2572_3957 461
61 3300042648 Ga0466709_366043 Ga0466709_366043_9092_10477 461
62 3300042652 Ga0466708_247588 Ga0466708_247588_10789_12174 461
63 iso_pr_bacteria 2820737921 2820738877 461
64 3300002462 JGI24702J35022_10005031 JGI24702J35022_100050317 462
65 3300002504 JGI24705J35276_12211111 JGI24705J35276_122111111 462
66 3300010167 Ga0123353_10496388 Ga0123353_104963881 462
67 3300042603 Ga0466714_053209 Ga0466714_053209_1513_2901 462
68 3300042612 Ga0466705_153953 Ga0466705_153953_3952_5340 462
69 3300042636 Ga0466703_412985 Ga0466703_412985_411_1799 462
70 3300042643 Ga0466704_613633 Ga0466704_613633_92_1480 462
71 3300042648 Ga0466709_404772 Ga0466709_404772_2690_4078 462
72 3300042652 Ga0466708_061894 Ga0466708_061894_2800_4188 462
73 3300042655 Ga0466727_042687 Ga0466727_042687_26107_27495 462
74 2225789004 2227080791 2227454118 463
75 3300042590 Ga0466690_265413 Ga0466690_265413_1061_2452 463
76 3300042590 Ga0466690_289464 Ga0466690_289464_233_1624 463
77 3300042591 Ga0466692_029952 Ga0466692_029952_3375_4766 463
78 3300042593 Ga0466691_032786 Ga0466691_032786_2644_4035 463
79 3300042593 Ga0466691_127674 Ga0466691_127674_2585_3976 463
80 3300042599 Ga0466706_104368 Ga0466706_104368_5139_6530 463
81 3300042602 Ga0466713_004830 Ga0466713_004830_13630_15021 463
82 3300042605 Ga0466716_014100 Ga0466716_014100_2521_3912 463
83 3300042606 Ga0466719_283993 Ga0466719_283993_1604_2995 463
84 3300042611 Ga0466697_150127 Ga0466697_150127_4442_5833 463
85 3300042612 Ga0466705_085012 Ga0466705_085012_290_1681 463
86 3300042615 Ga0466711_317316 Ga0466711_317316_836_2227 463
87 3300042616 Ga0466715_458370 Ga0466715_458370_10233_11624 463
88 3300042616 Ga0466715_565722 Ga0466715_565722_644_2035 463
89 3300042618 Ga0466723_162835 Ga0466723_162835_10060_11451 463
90 3300042619 Ga0466726_216938 Ga0466726_216938_7099_8490 463
91 3300042620 Ga0466728_328142 Ga0466728_328142_5037_6428 463
92 3300042620 Ga0466728_482084 Ga0466728_482084_3126_4517 463
93 3300042643 Ga0466704_035521 Ga0466704_035521_255_1646 463
94 3300042643 Ga0466704_475354 Ga0466704_475354_1786_3177 463
95 3300042652 Ga0466708_101521 Ga0466708_101521_7839_9230 463
96 iso_pr_bacteria 2820767225 2820767819 463
97 iso_pr_bacteria 2820772500 2820772650 463
98 3300000062 IMNBL1DRAFT_c0000765 IMNBL1DRAFT_00007652 464
99 3300000062 IMNBL1DRAFT_c0019456 IMNBL1DRAFT_00194562 464
100 3300002462 JGI24702J35022_10036711 JGI24702J35022_100367112 464
101 3300002834 JGI24696J40584_12938849 JGI24696J40584_129388491 464
102 3300010049 Ga0123356_10156757 Ga0123356_101567572 464
103 3300042603 Ga0466714_082032 Ga0466714_082032_168_1562 464
104 3300042643 Ga0466704_051910 Ga0466704_051910_2085_3479 464
105 3300042652 Ga0466708_069911 Ga0466708_069911_1238_2632 464
106 3300002462 JGI24702J35022_10021767 JGI24702J35022_100217671 465
107 3300010167 Ga0123353_10001720 Ga0123353_100017204 465
108 3300010167 Ga0123353_10458894 Ga0123353_104588943 465
109 3300042602 Ga0466713_065185 Ga0466713_065185_7281_8678 465
110 3300042616 Ga0466715_540931 Ga0466715_540931_2313_3710 465
111 3300042618 Ga0466723_140932 Ga0466723_140932_396_1793 465
112 iso_pr_bacteria 2820736622 2820737174 465
113 iso_pr_bacteria 2820740053 2820741681 465
114 3300002462 JGI24702J35022_10001486 JGI24702J35022_100014862 466
115 3300042604 Ga0466717_200839 Ga0466717_200839_138_1538 466
116 3300042655 Ga0466727_148661 Ga0466727_148661_84_1484 466
117 3300042594 Ga0466694_180729 Ga0466694_180729_16795_18198 467
118 3300042618 Ga0466723_326527 Ga0466723_326527_6606_8009 467
119 3300042593 Ga0466691_186282 Ga0466691_186282_75224_76633 469
120 3300042609 Ga0466722_239795 Ga0466722_239795_24_1436 470
121 3300042613 Ga0466710_416632 Ga0466710_416632_1113_2528 471
122 3300042599 Ga0466706_111816 Ga0466706_111816_7605_9026 473
123 3300042648 Ga0466709_404640 Ga0466709_404640_4779_6203 474
124 3300042656 Ga0466732_031869 Ga0466732_031869_57_1517 486
125 3300042596 Ga0466696_172325 Ga0466696_172325_9714_11186 490
126 3300010167 Ga0123353_10057420 Ga0123353_100574203 492

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05195 AMP_N Aminopeptidase P, N-terminal domain 35 147 0.96
PF00557 Peptidase_M24 Metallopeptidase family M24 203 467 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.