Protein Family IF03052

Metagenome Isolate
146 Members
68 Samples
129 Scaffolds
394.95 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10006246|Ga0123353_1000624613
Length
436 aa
Sequence
MIITPGQSHPHLLNLQELNTEMSNFVHYITDTQIIPLLKGGCTMSEKMLFIDEALASLQESGLYNNIRAIESAQGAWLQIEGKKVLNMCSNNYLGLANHPRLVQAAKAAIDKYGVGPAAVRSIAGTQSIHEELDQEVAKFKHAEAALTLQGGFLANQAVIPSLVGKTDTILSDELNHASIIDGARLSSAKIKVFRHKDLAHLEELLQGPNDGRVLVITDGVFSMDGDIGDLDKIVELCEKYGAMSMVDDAHGEGVLGSHGRGIVDHFKLHGRCDVEIGTFSKAIGTVGGFVAGSAKLITYLKQRARPFLFSSALPAADVGATLEAFRLLQESDELVQKLWENARFFKQGMQDLGFDTGLSQTPITPVMIGEADVARQFSALLFTKGIFAMAIGFPTVPRGKARIRVMISASHSRGDLEFALEKFAAAGKEMELIS*

📊 Sample Types

Isolate 11.6%
Metagenome 88.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 23.0%
Unclassified 18.0%
Termitidae 11.5%
Drosophilidae 8.2%
Armadillidiidae 6.6%
Formicidae 6.6%
Termopsidae 6.6%
Rhinotermitidae 4.9%
Stratiomyidae 3.3%
Hydrophilidae 1.6%
Passalidae 1.6%
Tenebrionidae 1.6%
Hodotermitidae 1.6%
Bombycidae 1.6%
Syrphidae 1.6%
Culicidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 128
Eukaryota 0
Viruses 0
Unclassified 18

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2540341223 Entomoplasma lucivorax ATCC 49196 Isolate Unclassified
2 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
3 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
6 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
9 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
10 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
11 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
15 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
16 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
17 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
18 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
21 2820451402 Unclassified Firmicutes Lab288P3bin174 Isolate Unclassified
22 2554235371 Spiroplasma chrysopicola DF-1 Isolate Unclassified
23 2896321640 Sphingobacterium sp. xlx-130 Isolate
24 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
25 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
26 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
27 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
32 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
33 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
34 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
37 2540341224 Williamsoniiplasma luminosum ATCC 49195 Isolate Unclassified
38 2545824514 Entomoplasma somnilux ATCC 49194 Isolate Unclassified
39 2898741527 Sphingobacterium sp. xlx-73 Isolate
40 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
41 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
42 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
43 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
44 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
45 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
46 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
47 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
48 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
49 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
50 2554235381 Spiroplasma syrphidicola EA-1 Isolate Syrphidae
51 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
52 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
53 2896330536 Sphingobacterium sp. xlx-96 Isolate
54 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
55 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
56 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
57 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
58 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
59 2896350215 Sphingobacterium sp. xlx-183 Isolate
60 3300007058 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut Metagenome Drosophilidae
61 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
62 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
63 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
64 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
65 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
66 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
67 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
68 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0104045_1004595 3300007085 Bacteria 2486
2 Ga0466715_456889 3300042616 Bacteria 238254
3 Ga0466657_076401 3300042582 Bacteria 4123
4 Ga0466690_320410 3300042590 Bacteria 2067
5 Ga0466691_120862 3300042593 Unclassified 10979
6 Ga0466729_258677 3300042621 Bacteria 2630
7 Ga0466704_042699 3300042643 Unclassified 5088
8 Ga0466724_60582 3300042649 Bacteria 15643
9 Ga0466727_171176 3300042655 Bacteria 4661
10 Ga0466713_044417 3300042602 Bacteria 52236
11 Ga0466714_114479 3300042603 Bacteria 31091
12 Ga0466716_067235 3300042605 Unclassified 6342
13 Ga0466719_255900 3300042606 Bacteria 9766
14 Ga0123353_10006246 3300010167 Bacteria 15840
15 Ga0160465_100043 3300012803 Bacteria 157730
16 Ga0068302_10007084 3300005071 Unclassified 8647
17 Ga0068305_10000012 3300005083 Bacteria 51331
18 Ga0068305_10000195 3300005083 Bacteria 118813
19 Ga0068305_10004980 3300005083 Bacteria 28780
20 Ga0104048_1168691 3300007143 Bacteria 3124
21 Ga0123357_10002132 3300009784 Bacteria 21798
22 Ga0466711_246643 3300042615 Bacteria 90615
23 Ga0466726_127071 3300042619 Unclassified 7076
24 Ga0466729_082100 3300042621 Bacteria 22893
25 Ga0160433_100059 3300012846 Bacteria 121476
26 Ga0160433_101000 3300012846 Bacteria 9162
27 Ga0466703_250320 3300042636 Bacteria 592480
28 Ga0466709_147662 3300042648 Bacteria 13278
29 Ga0466724_46127 3300042649 Unclassified 1920
30 Ga0466708_300777 3300042652 Bacteria 4806
31 Ga0466701_099620 3300042598 Bacteria 6158
32 Ga0466706_010392 3300042599 Bacteria 27140
33 Ga0466719_174688 3300042606 Unclassified 88641
34 Ga0123353_10333209 3300010167 Bacteria 2296
35 Ga0102735_1006094 3300007080 Bacteria 1534
36 Ga0466711_227825 3300042615 Bacteria 191336
37 Ga0466711_420694 3300042615 Bacteria 7586
38 Ga0466715_226060 3300042616 Bacteria 48516
39 Ga0466723_276603 3300042618 Bacteria 34293
40 Ga0466723_331045 3300042618 Bacteria 47901
41 Ga0160458_100038 3300012832 Bacteria 185944
42 Ga0160455_100182 3300012837 Bacteria 62069
43 Ga0160433_100918 3300012846 Unclassified 9894
44 Ga0466691_094912 3300042593 Bacteria 7898
45 Ga0466696_047871 3300042596 Bacteria 4290
46 Ga0466703_158285 3300042636 Bacteria 84792
47 Ga0466727_067151 3300042655 Bacteria 68251
48 Ga0466716_110108 3300042605 Bacteria 10788
49 Ga0466705_073622 3300042612 Bacteria 20606
50 Ga0104043_1000407 3300007058 Unclassified 2165
51 Ga0104045_1074804 3300007085 Bacteria 2454
52 Ga0104019_1005211 3300007150 Unclassified 4323
53 Ga0466723_208657 3300042618 Bacteria 23133
54 Ga0466726_065940 3300042619 Bacteria 154230
55 Ga0466726_345134 3300042619 Bacteria 52575
56 Ga0466726_387678 3300042619 Bacteria 397429
57 Ga0466728_001522 3300042620 Bacteria 31939
58 Ga0466728_033444 3300042620 Bacteria 4662
59 Ga0466728_346008 3300042620 Bacteria 130078
60 Ga0160456_100058 3300012820 Bacteria 167928
61 Ga0466690_012079 3300042590 Bacteria 1877
62 Ga0466690_373341 3300042590 Bacteria 47139
63 Ga0466704_012171 3300042643 Bacteria 3401
64 Ga0466727_063582 3300042655 Bacteria 93834
65 Ga0466727_150924 3300042655 Bacteria 116830
66 CVPL010W_10008400 3300002931 Bacteria 9775
67 Ga0068305_10000184 3300005083 Bacteria 99663
68 Ga0466715_253178 3300042616 Bacteria 66046
69 Ga0466715_381748 3300042616 Bacteria 14771
70 Ga0466715_636825 3300042616 Unclassified 7861
71 Ga0466723_133842 3300042618 Bacteria 68745
72 Ga0466723_259748 3300042618 Bacteria 40517
73 Ga0466726_230469 3300042619 Bacteria 1742
74 Ga0160431_103309 3300012828 Bacteria 3372
75 Ga0160445_100493 3300012847 Bacteria 19557
76 Ga0466690_269035 3300042590 Bacteria 23958
77 Ga0466691_137223 3300042593 Unclassified 5864
78 Ga0466696_330331 3300042596 Bacteria 41193
79 Ga0466704_488680 3300042643 Bacteria 17243
80 Ga0466713_005286 3300042602 Bacteria 50542
81 Ga0466722_193176 3300042609 Bacteria 4628
82 Ga0562378_0348 3300056814 Bacteria 90098
83 Ga0160466_100046 3300012809 Bacteria 160488
84 Ga0068302_10010414 3300005071 Bacteria 9615
85 Ga0068302_10040106 3300005071 Bacteria 4624
86 Ga0068305_10000253 3300005083 Bacteria 49207
87 Ga0104019_1191683 3300007150 Bacteria 1755
88 Ga0466711_117944 3300042615 Bacteria 215972
89 Ga0466715_347031 3300042616 Bacteria 23088
90 Ga0466715_623834 3300042616 Bacteria 48519
91 Ga0466728_357480 3300042620 Bacteria 11417
92 Ga0466729_174394 3300042621 Unclassified 1254
93 Ga0466690_010270 3300042590 Bacteria 16820
94 Ga0466731_348255 3300042622 Bacteria 3778
95 Ga0466704_230037 3300042643 Unclassified 3061
96 Ga0466704_598763 3300042643 Bacteria 17001
97 Ga0466707_408636 3300042601 Bacteria 5154
98 Ga0466716_228486 3300042605 Bacteria 6613
99 Ga0466705_147979 3300042612 Bacteria 167577
100 Ga0466705_208486 3300042612 Bacteria 71494
101 Ga0466705_237340 3300042612 Bacteria 2419
102 Ga0466705_260526 3300042612 Bacteria 19969
103 IMNBGM34_c001231 3300000036 Bacteria 4742
104 Ga0102740_1000096 3300007140 Bacteria 21903
105 Ga0466726_021843 3300042619 Bacteria 19287
106 Ga0466726_024804 3300042619 Bacteria 9331
107 Ga0160455_100334 3300012837 Bacteria 28393
108 Ga0466690_154797 3300042590 Unclassified 7527
109 Ga0466703_178972 3300042636 Unclassified 135766
110 Ga0466704_138143 3300042643 Bacteria 11080
111 Ga0466704_370727 3300042643 Bacteria 76606
112 Ga0466727_084042 3300042655 Bacteria 2501
113 Ga0466719_127211 3300042606 Bacteria 279481
114 Ga0466705_257501 3300042612 Bacteria 57239
115 Ga0123357_10048053 3300009784 Bacteria 5783
116 Ga0123353_10001611 3300010167 Bacteria 27817
117 Ga0102734_1006998 3300007129 Bacteria 2541
118 Ga0104050_1001591 3300007153 Bacteria 8076
119 Ga0466711_035040 3300042615 Bacteria 61430
120 Ga0466711_044341 3300042615 Bacteria 37002
121 Ga0466715_642600 3300042616 Unclassified 2866
122 Ga0466723_070343 3300042618 Bacteria 9465
123 Ga0466729_100036 3300042621 Bacteria 6661
124 Ga0466692_029697 3300042591 Bacteria 4817
125 Ga0466735_075060 3300042624 Bacteria 5381
126 Ga0466704_097093 3300042643 Unclassified 8821
127 Ga0466727_245898 3300042655 Bacteria 31197
128 Ga0466706_031300 3300042599 Bacteria 209681
129 Ga0466719_527379 3300042606 Bacteria 121423

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00155 Aminotran_1_2 Aminotransferase class I and II 83 423 0.95
PF00266 Aminotran_5 Aminotransferase class-V 126 250 0.85

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.