Protein Family IF03004

Metagenome Isolate
120 Members
33 Samples
119 Scaffolds
99.01 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_13996198|Ga0123356_139961981
Length
115 aa
Sequence
MKKRNKLPETNNFWRVKMTYSKEEKTMWLEDWQKSGKGAWAYAKENGLIPQTFVTWTKKEQKEKTEFVEIKTKIKQKLQTSEILIEKGDIKIHLPFGMSSNELSSIIECIRAAL*

📊 Sample Types

Isolate 0.8%
Metagenome 99.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 96.7%
Unclassified 3.3%

🌳 Taxonomy

Archaea 0
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
4 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
5 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
6 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
7 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
17 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
18 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
19 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
25 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
26 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
29 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
30 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
31 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
32 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
33 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466701_030480 3300042598 Bacteria 3802
2 Ga0466700_387300 3300042600 Bacteria 1352
3 Ga0466720_180350 3300042607 Bacteria 1775
4 Ga0466702_267984 3300042635 Unclassified 1249
5 Ga0123355_11228942 3300009826 Bacteria 761
6 Ga0123356_10807102 3300010049 Bacteria 1109
7 Ga0123356_10865733 3300010049 Bacteria 1075
8 Ga0123356_11174224 3300010049 Bacteria 934
9 Ga0123356_13996198 3300010049 Bacteria 508
10 JGI24695J34938_10001906 3300002450 Unclassified 16850
11 JGI24695J34938_10022707 3300002450 Unclassified 3039
12 JGI24695J34938_10179833 3300002450 Bacteria 875
13 Ga0072941_1032663 3300005201 Bacteria 641
14 Ga0466720_072526 3300042607 Bacteria 11119
15 Ga0415639_016892 3300038395 Bacteria 6046
16 Ga0466693_107213 3300042592 Bacteria 1545
17 Ga0466712_023240 3300042614 Bacteria 1189
18 Ga0466724_39644 3300042649 Bacteria 1203
19 Ga0123356_10066087 3300010049 Bacteria 3384
20 Ga0123356_10230114 3300010049 Bacteria 1917
21 Ga0123356_12045331 3300010049 Bacteria 715
22 Ga0123353_11443191 3300010167 Bacteria 881
23 Ga0123353_12611164 3300010167 Bacteria 597
24 JGI24702J35022_10392214 3300002462 Bacteria 837
25 Ga0074263_117214 3300005485 Bacteria 1515
26 Ga0466701_039719 3300042598 Bacteria 1130
27 Ga0466734_135256 3300042623 Bacteria 2628
28 Ga0123356_10083081 3300010049 Bacteria 3034
29 Ga0123356_10862109 3300010049 Bacteria 1077
30 Ga0123356_13647832 3300010049 Bacteria 533
31 Ga0123353_11267172 3300010167 Bacteria 960
32 Ga0123353_12817876 3300010167 Unclassified 569
33 Ga0123353_12981441 3300010167 Unclassified 549
34 Nasutiter_Contig47445 2030936001 Bacteria 2107
35 FAAS_10659484 3300001880 Bacteria 519
36 JGI24698J34947_10225682 3300002449 Bacteria 715
37 JGI24698J34947_10302796 3300002449 Unclassified 575
38 JGI24697J35500_10532458 3300002507 Unclassified 549
39 Ga0072940_1016145 3300005200 Bacteria 1404
40 Ga0466720_137966 3300042607 Bacteria 8068
41 Ga0466720_216507 3300042607 Bacteria 1171
42 Ga0264413_108010 3300024493 Bacteria 6761
43 Ga0466731_028672 3300042622 Bacteria 2890
44 Ga0466731_342466 3300042622 Bacteria 1058
45 Ga0123356_10063017 3300010049 Bacteria 3464
46 Ga0123356_10095610 3300010049 Bacteria 2840
47 Ga0123356_10231856 3300010049 Bacteria 1911
48 Ga0123356_10334883 3300010049 Bacteria 1632
49 Ga0123356_10861054 3300010049 Bacteria 1077
50 Ga0123356_10973157 3300010049 Bacteria 1019
51 Ga0123356_11025379 3300010049 Bacteria 995
52 Ga0123356_11141020 3300010049 Bacteria 947
53 Ga0123356_12300188 3300010049 Bacteria 674
54 Ga0123356_12732067 3300010049 Unclassified 618
55 Ga0123353_10097678 3300010167 Bacteria 4734
56 JGI24698J34947_10152528 3300002449 Bacteria 957
57 JGI24698J34947_10229181 3300002449 Bacteria 707
58 JGI24698J34947_10257660 3300002449 Bacteria 648
59 JGI24695J34938_10390553 3300002450 Bacteria 619
60 Ga0466697_277056 3300042611 Bacteria 2754
61 Ga0415639_017116 3300038395 Bacteria 1280
62 Ga0466657_113121 3300042582 Bacteria 3214
63 Ga0123355_11340638 3300009826 Bacteria 713
64 Ga0123356_10069313 3300010049 Bacteria 3307
65 Ga0123356_11087974 3300010049 Bacteria 968
66 Ga0123354_10709313 3300010882 Unclassified 700
67 JGI24698J34947_10112735 3300002449 Bacteria 1196
68 JGI24698J34947_10283133 3300002449 Unclassified 605
69 JGI24695J34938_10042036 3300002450 Bacteria 2048
70 JGI24702J35022_10057675 3300002462 Bacteria 2073
71 JGI24702J35022_10594398 3300002462 Bacteria 684
72 Ga0074263_104800 3300005485 Bacteria 2661
73 Ga0466700_212952 3300042600 Bacteria 1145
74 Ga0466717_114012 3300042604 Bacteria 4448
75 Ga0415639_054076 3300038395 Bacteria 1497
76 Ga0466695_311000 3300042595 Bacteria 2846
77 Ga0466712_214413 3300042614 Bacteria 1502
78 Ga0466731_126036 3300042622 Bacteria 3190
79 Ga0123357_10956301 3300009784 Unclassified 541
80 Ga0123356_10060033 3300010049 Bacteria 3548
81 Ga0123356_10522840 3300010049 Bacteria 1345
82 Ga0123356_11014789 3300010049 Bacteria 1000
83 Ga0123356_11743158 3300010049 Bacteria 773
84 JGI24698J34947_10093435 3300002449 Bacteria 1373
85 JGI24698J34947_10285263 3300002449 Bacteria 602
86 JGI24695J34938_10054598 3300002450 Bacteria 1731
87 JGI24695J34938_10110980 3300002450 Bacteria 1117
88 JGI24702J35022_10149824 3300002462 Bacteria 1308
89 JGI24702J35022_10388872 3300002462 Bacteria 840
90 JGI24702J35022_10390084 3300002462 Bacteria 839
91 JGI24702J35022_10940086 3300002462 Bacteria 538
92 JGI24696J40584_12707070 3300002834 Bacteria 744
93 Ga0466701_021445 3300042598 Bacteria 3412
94 Ga0466657_203878 3300042582 Bacteria 1007
95 Ga0466712_160587 3300042614 Bacteria 1290
96 Ga0466731_043360 3300042622 Bacteria 1292
97 Ga0466731_051963 3300042622 Bacteria 1138
98 Ga0466731_285790 3300042622 Bacteria 1415
99 Ga0123356_10985986 3300010049 Bacteria 1013
100 Ga0123356_12108018 3300010049 Bacteria 704
101 Ga0123356_12213783 3300010049 Bacteria 687
102 Ga0123356_12479351 3300010049 Unclassified 649
103 Ga0123356_12518876 3300010049 Bacteria 644
104 Ga0123353_12004582 3300010167 Bacteria 709
105 JGI24698J34947_10193891 3300002449 Bacteria 801
106 JGI24696J40584_12906611 3300002834 Bacteria 1222
107 Ga0072941_1039323 3300005201 Bacteria 707
108 Ga0466717_156927 3300042604 Bacteria 1505
109 Ga0466720_053196 3300042607 Bacteria 2783
110 Ga0466698_095125 3300042610 Bacteria 2723
111 Ga0466731_262144 3300042622 Bacteria 1457
112 Ga0123356_10576605 3300010049 Unclassified 1288
113 Ga0123356_13447918 3300010049 Bacteria 548
114 Ga0123353_10199243 3300010167 Bacteria 3152
115 Ga0123353_10631382 3300010167 Bacteria 1522
116 Ga0123353_11455790 3300010167 Bacteria 876
117 AustNasuHG_c1004409 3300000089 Bacteria 5048
118 JGI24698J34947_10363703 3300002449 Bacteria 503
119 JGI24695J34938_10269003 3300002450 Bacteria 728

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002450 JGI24695J34938_10001906 JGI24695J34938_100019063 85
2 3300010167 Ga0123353_12981441 Ga0123353_129814412 90
3 3300010049 Ga0123356_12732067 Ga0123356_127320672 92
4 3300002450 JGI24695J34938_10110980 JGI24695J34938_101109803 96
5 3300005201 Ga0072941_1032663 Ga0072941_10326632 96
6 3300005201 Ga0072941_1039323 Ga0072941_10393232 96
7 3300010049 Ga0123356_10063017 Ga0123356_100630171 96
8 3300010049 Ga0123356_13447918 Ga0123356_134479182 96
9 3300042582 Ga0466657_203878 Ga0466657_203878_162_452 96
10 3300042600 Ga0466700_212952 Ga0466700_212952_159_449 96
11 3300042600 Ga0466700_387300 Ga0466700_387300_659_949 96
12 3300002462 JGI24702J35022_10149824 JGI24702J35022_101498241 97
13 3300009826 Ga0123355_11340638 Ga0123355_113406382 97
14 3300010049 Ga0123356_11014789 Ga0123356_110147891 97
15 3300010049 Ga0123356_13647832 Ga0123356_136478321 97
16 3300038395 Ga0415639_054076 Ga0415639_054076_1022_1315 97
17 3300042598 Ga0466701_021445 Ga0466701_021445_523_816 97
18 3300042611 Ga0466697_277056 Ga0466697_277056_1518_1811 97
19 iso_pr_bacteria 2781125663 2781339008 97
20 2030936001 Nasutiter_Contig47445 Nasutiterm_211420 98
21 3300000089 AustNasuHG_c1004409 AustNasuHG_10044093 98
22 3300002450 JGI24695J34938_10042036 JGI24695J34938_100420363 98
23 3300002450 JGI24695J34938_10179833 JGI24695J34938_101798331 98
24 3300002450 JGI24695J34938_10269003 JGI24695J34938_102690032 98
25 3300002462 JGI24702J35022_10057675 JGI24702J35022_100576751 98
26 3300002834 JGI24696J40584_12906611 JGI24696J40584_129066113 98
27 3300010049 Ga0123356_10066087 Ga0123356_100660872 98
28 3300010049 Ga0123356_10069313 Ga0123356_100693133 98
29 3300010049 Ga0123356_10083081 Ga0123356_100830814 98
30 3300010049 Ga0123356_10095610 Ga0123356_100956103 98
31 3300010049 Ga0123356_10230114 Ga0123356_102301141 98
32 3300010049 Ga0123356_10231856 Ga0123356_102318561 98
33 3300010049 Ga0123356_10334883 Ga0123356_103348833 98
34 3300010049 Ga0123356_10522840 Ga0123356_105228403 98
35 3300010049 Ga0123356_10807102 Ga0123356_108071022 98
36 3300010049 Ga0123356_10865733 Ga0123356_108657331 98
37 3300010049 Ga0123356_10973157 Ga0123356_109731571 98
38 3300010049 Ga0123356_11087974 Ga0123356_110879742 98
39 3300010049 Ga0123356_11141020 Ga0123356_111410202 98
40 3300010049 Ga0123356_12045331 Ga0123356_120453311 98
41 3300010049 Ga0123356_12300188 Ga0123356_123001882 98
42 3300010167 Ga0123353_10097678 Ga0123353_100976785 98
43 3300010167 Ga0123353_10199243 Ga0123353_101992431 98
44 3300010167 Ga0123353_11267172 Ga0123353_112671723 98
45 3300010167 Ga0123353_12004582 Ga0123353_120045822 98
46 3300024493 Ga0264413_108010 Ga0264413_1080105 98
47 3300042582 Ga0466657_113121 Ga0466657_113121_165_461 98
48 3300042595 Ga0466695_311000 Ga0466695_311000_2090_2386 98
49 3300042604 Ga0466717_114012 Ga0466717_114012_2676_2972 98
50 3300042607 Ga0466720_053196 Ga0466720_053196_82_378 98
51 3300042607 Ga0466720_072526 Ga0466720_072526_2998_3294 98
52 3300042607 Ga0466720_137966 Ga0466720_137966_7587_7883 98
53 3300042607 Ga0466720_180350 Ga0466720_180350_143_439 98
54 3300042607 Ga0466720_216507 Ga0466720_216507_612_908 98
55 3300042610 Ga0466698_095125 Ga0466698_095125_956_1252 98
56 3300042614 Ga0466712_214413 Ga0466712_214413_977_1273 98
57 3300042622 Ga0466731_028672 Ga0466731_028672_231_527 98
58 3300042623 Ga0466734_135256 Ga0466734_135256_165_461 98
59 3300001880 FAAS_10659484 FAAS_106594841 99
60 3300002449 JGI24698J34947_10093435 JGI24698J34947_100934353 99
61 3300002449 JGI24698J34947_10112735 JGI24698J34947_101127353 99
62 3300002449 JGI24698J34947_10152528 JGI24698J34947_101525282 99
63 3300002449 JGI24698J34947_10193891 JGI24698J34947_101938912 99
64 3300002449 JGI24698J34947_10225682 JGI24698J34947_102256821 99
65 3300002449 JGI24698J34947_10229181 JGI24698J34947_102291812 99
66 3300002449 JGI24698J34947_10257660 JGI24698J34947_102576602 99
67 3300002449 JGI24698J34947_10283133 JGI24698J34947_102831331 99
68 3300002449 JGI24698J34947_10285263 JGI24698J34947_102852631 99
69 3300002449 JGI24698J34947_10302796 JGI24698J34947_103027961 99
70 3300002449 JGI24698J34947_10363703 JGI24698J34947_103637031 99
71 3300002462 JGI24702J35022_10388872 JGI24702J35022_103888721 99
72 3300002462 JGI24702J35022_10392214 JGI24702J35022_103922141 99
73 3300002462 JGI24702J35022_10594398 JGI24702J35022_105943982 99
74 3300002462 JGI24702J35022_10940086 JGI24702J35022_109400861 99
75 3300002507 JGI24697J35500_10532458 JGI24697J35500_105324581 99
76 3300005200 Ga0072940_1016145 Ga0072940_10161452 99
77 3300005485 Ga0074263_104800 Ga0074263_1048002 99
78 3300005485 Ga0074263_117214 Ga0074263_1172142 99
79 3300010049 Ga0123356_10060033 Ga0123356_100600334 99
80 3300010049 Ga0123356_11025379 Ga0123356_110253793 99
81 3300010049 Ga0123356_11743158 Ga0123356_117431582 99
82 3300010049 Ga0123356_12108018 Ga0123356_121080182 99
83 3300010049 Ga0123356_12518876 Ga0123356_125188761 99
84 3300010167 Ga0123353_11443191 Ga0123353_114431912 99
85 3300010167 Ga0123353_11455790 Ga0123353_114557902 99
86 3300010167 Ga0123353_12611164 Ga0123353_126111641 99
87 3300010167 Ga0123353_12817876 Ga0123353_128178761 99
88 3300010882 Ga0123354_10709313 Ga0123354_107093131 99
89 3300042592 Ga0466693_107213 Ga0466693_107213_253_552 99
90 3300042598 Ga0466701_030480 Ga0466701_030480_251_550 99
91 3300042622 Ga0466731_043360 Ga0466731_043360_337_636 99
92 3300042622 Ga0466731_342466 Ga0466731_342466_185_484 99
93 3300002450 JGI24695J34938_10022707 JGI24695J34938_100227072 100
94 3300002450 JGI24695J34938_10054598 JGI24695J34938_100545983 100
95 3300002450 JGI24695J34938_10390553 JGI24695J34938_103905532 100
96 3300002834 JGI24696J40584_12707070 JGI24696J40584_127070702 100
97 3300042604 Ga0466717_156927 Ga0466717_156927_324_626 100
98 3300042635 Ga0466702_267984 Ga0466702_267984_336_638 100
99 3300010049 Ga0123356_10862109 Ga0123356_108621092 101
100 3300042614 Ga0466712_160587 Ga0466712_160587_810_1115 101
101 3300042598 Ga0466701_039719 Ga0466701_039719_149_457 102
102 3300042614 Ga0466712_023240 Ga0466712_023240_223_531 102
103 3300009784 Ga0123357_10956301 Ga0123357_109563011 103
104 3300009826 Ga0123355_11228942 Ga0123355_112289422 103
105 3300010049 Ga0123356_10861054 Ga0123356_108610542 103
106 3300010049 Ga0123356_10985986 Ga0123356_109859862 103
107 3300010049 Ga0123356_11174224 Ga0123356_111742243 103
108 3300010049 Ga0123356_12479351 Ga0123356_124793512 103
109 3300042622 Ga0466731_051963 Ga0466731_051963_159_470 103
110 3300042622 Ga0466731_126036 Ga0466731_126036_2412_2723 103
111 3300042622 Ga0466731_262144 Ga0466731_262144_296_607 103
112 3300042622 Ga0466731_285790 Ga0466731_285790_891_1202 103
113 3300042649 Ga0466724_39644 Ga0466724_39644_43_354 103
114 3300010049 Ga0123356_10576605 Ga0123356_105766052 104
115 3300010049 Ga0123356_12213783 Ga0123356_122137832 104
116 3300038395 Ga0415639_016892 Ga0415639_016892_1552_1866 104
117 3300038395 Ga0415639_017116 Ga0415639_017116_109_423 104
118 3300010167 Ga0123353_10631382 Ga0123353_106313823 105
119 3300002462 JGI24702J35022_10390084 JGI24702J35022_103900842 107
120 3300010049 Ga0123356_13996198 Ga0123356_139961981 115

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.43 0.72 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.