Protein Family IF02967
Metagenome
Metatranscriptome
Isolate
128
Members
56
Samples
123
Scaffolds
123.7
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_11219425|Ga0123356_112194252
- Length
- 143 aa
- Sequence
- MRIENWRRGIMAKMTLEELRKLRDTTKTEITRREVEGKEIQVIVGMGTCGIAAGAKATLDTFLRSLDENGLVETVMVRQTGCMGLCHSEPTVEVVVPGMPAIIYGNVDSAVAKEIITKHIIGRELLASNILDRPAGDIIATK*
Sample Types
Isolate
3.9%
Metagenome
92.2%
MAG
0.0%
Metatranscriptome
3.9%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
56.0%
Kalotermitidae
20.0%
Unclassified
16.0%
Termopsidae
4.0%
Rhinotermitidae
2.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
118
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 11 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 17 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 18 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 19 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 20 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 21 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 22 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 23 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 26 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 27 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 38 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 39 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 45 | 3300021229 | Termite gut microbial communities from nest from French Guiana - 12-5 mRNA SA | Metatranscriptome | Termitidae |
| 46 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 47 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 48 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 49 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 50 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 51 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 52 | 3300021220 | Termite gut microbial communities from nest from French Guiana - FG16_9_6 mRNA SA | Metatranscriptome | |
| 53 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 54 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 55 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 56 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10160790 | 3300010049 | Bacteria | 2243 |
| 2 | Ga0123356_12153583 | 3300010049 | Bacteria | 696 |
| 3 | Ga0123353_10236714 | 3300010167 | Unclassified | 2841 |
| 4 | Ga0123353_10388479 | 3300010167 | Bacteria | 2083 |
| 5 | Ga0123353_11100766 | 3300010167 | Bacteria | 1055 |
| 6 | Ga0223674_1008652 | 3300021235 | Bacteria | 999 |
| 7 | Ga0466699_426114 | 3300042597 | Bacteria | 2061 |
| 8 | FAAS_10000652 | 3300001880 | Bacteria | 1592 |
| 9 | JGI24698J34947_10040513 | 3300002449 | Bacteria | 2404 |
| 10 | JGI24695J34938_10102068 | 3300002450 | Unclassified | 1171 |
| 11 | JGI24702J35022_10093754 | 3300002462 | Bacteria | 1637 |
| 12 | Ga0466710_000750 | 3300042613 | Bacteria | 1305 |
| 13 | Ga0466712_120111 | 3300042614 | Bacteria | 38676 |
| 14 | Ga0466715_162526 | 3300042616 | Bacteria | 4260 |
| 15 | Ga0466718_068381 | 3300042617 | Bacteria | 1011 |
| 16 | Ga0466706_110102 | 3300042599 | Bacteria | 6920 |
| 17 | Ga0466700_267426 | 3300042600 | Bacteria | 1861 |
| 18 | Ga0466702_233829 | 3300042635 | Bacteria | 1358 |
| 19 | Ga0466705_036295 | 3300042612 | Bacteria | 5574 |
| 20 | Ga0123356_12783779 | 3300010049 | Bacteria | 612 |
| 21 | Ga0223674_1008654 | 3300021235 | Bacteria | 2653 |
| 22 | Ga0223677_1008160 | 3300021239 | Bacteria | 953 |
| 23 | AustNasuHG_c1002533 | 3300000089 | Bacteria | 6605 |
| 24 | JGI24698J34947_10084122 | 3300002449 | Unclassified | 1482 |
| 25 | JGI24695J34938_10004896 | 3300002450 | Bacteria | 8575 |
| 26 | JGI24695J34938_10017368 | 3300002450 | Bacteria | 3626 |
| 27 | JGI24695J34938_10019467 | 3300002450 | Bacteria | 3364 |
| 28 | JGI24695J34938_10053573 | 3300002450 | Bacteria | 1754 |
| 29 | JGI24696J40584_12918368 | 3300002834 | Bacteria | 1321 |
| 30 | Ga0466715_389463 | 3300042616 | Bacteria | 3151 |
| 31 | Ga0466726_486466 | 3300042619 | Bacteria | 1846 |
| 32 | Ga0466721_106813 | 3300042608 | Bacteria | 7353 |
| 33 | Ga0466703_190143 | 3300042636 | Bacteria | 35240 |
| 34 | Ga0466704_403150 | 3300042643 | Bacteria | 3258 |
| 35 | Ga0466709_223995 | 3300042648 | Bacteria | 21835 |
| 36 | Ga0466732_272301 | 3300042656 | Bacteria | 1161 |
| 37 | Ga0466733_075660 | 3300042659 | Bacteria | 7312 |
| 38 | Ga0123357_10545580 | 3300009784 | Bacteria | 929 |
| 39 | Ga0123353_10352156 | 3300010167 | Bacteria | 2218 |
| 40 | Ga0466690_084793 | 3300042590 | Bacteria | 8560 |
| 41 | Ga0466690_351568 | 3300042590 | Unclassified | 1464 |
| 42 | Ga0466695_251590 | 3300042595 | Bacteria | 1089 |
| 43 | Ga0466699_009887 | 3300042597 | Bacteria | 7645 |
| 44 | Ga0466699_202586 | 3300042597 | Bacteria | 1477 |
| 45 | JGI24698J34947_10221709 | 3300002449 | Unclassified | 725 |
| 46 | JGI24695J34938_10107655 | 3300002450 | Bacteria | 1137 |
| 47 | Ga0068305_11052486 | 3300005083 | Bacteria | 684 |
| 48 | Ga0072941_1043620 | 3300005201 | Bacteria | 5372 |
| 49 | Ga0466723_093729 | 3300042618 | Bacteria | 11545 |
| 50 | Ga0466698_029440 | 3300042610 | Bacteria | 4564 |
| 51 | Ga0466730_031001 | 3300042625 | Bacteria | 1748 |
| 52 | Ga0466708_365429 | 3300042652 | Bacteria | 22126 |
| 53 | Ga0123356_12063222 | 3300010049 | Bacteria | 712 |
| 54 | Ga0415639_140348 | 3300038395 | Bacteria | 1053 |
| 55 | Ga0466690_374463 | 3300042590 | Bacteria | 1683 |
| 56 | Ga0466694_028653 | 3300042594 | Bacteria | 6354 |
| 57 | Ga0466694_035299 | 3300042594 | Bacteria | 1018 |
| 58 | JGI24695J34938_10010936 | 3300002450 | Bacteria | 4926 |
| 59 | JGI24702J35022_10078655 | 3300002462 | Bacteria | 1785 |
| 60 | JGI24705J35276_12228638 | 3300002504 | Bacteria | 3226 |
| 61 | Ga0466718_017363 | 3300042617 | Bacteria | 1097 |
| 62 | Ga0466726_182246 | 3300042619 | Unclassified | 1061 |
| 63 | Ga0466707_039514 | 3300042601 | Bacteria | 2147 |
| 64 | Ga0466716_116972 | 3300042605 | Bacteria | 1755 |
| 65 | Ga0466719_024851 | 3300042606 | Bacteria | 10321 |
| 66 | Ga0466735_021167 | 3300042624 | Bacteria | 2303 |
| 67 | Ga0466703_086333 | 3300042636 | Bacteria | 22187 |
| 68 | Ga0466703_273870 | 3300042636 | Bacteria | 1180 |
| 69 | Ga0466704_128730 | 3300042643 | Bacteria | 3175 |
| 70 | Ga0223680_103159 | 3300021220 | Bacteria | 614 |
| 71 | Ga0415639_018920 | 3300038395 | Bacteria | 1664 |
| 72 | JGI24695J34938_10002207 | 3300002450 | Bacteria | 15172 |
| 73 | JGI24695J34938_10101879 | 3300002450 | Bacteria | 1173 |
| 74 | Ga0072941_1017879 | 3300005201 | Bacteria | 9528 |
| 75 | Ga0123357_10000299 | 3300009784 | Bacteria | 47335 |
| 76 | Ga0466715_222787 | 3300042616 | Bacteria | 9895 |
| 77 | Ga0466715_372079 | 3300042616 | Bacteria | 2825 |
| 78 | Ga0466700_464047 | 3300042600 | Bacteria | 1976 |
| 79 | Ga0466713_080228 | 3300042602 | Bacteria | 6601 |
| 80 | Ga0466717_165824 | 3300042604 | Bacteria | 1649 |
| 81 | Ga0466719_357042 | 3300042606 | Bacteria | 1084 |
| 82 | Ga0466719_445368 | 3300042606 | Bacteria | 18561 |
| 83 | Ga0466724_69529 | 3300042649 | Bacteria | 1472 |
| 84 | Ga0466732_334336 | 3300042656 | Bacteria | 1891 |
| 85 | Ga0123353_10620656 | 3300010167 | Bacteria | 1539 |
| 86 | Ga0264413_121230 | 3300024493 | Unclassified | 1382 |
| 87 | Ga0466699_405230 | 3300042597 | Bacteria | 1720 |
| 88 | JGI24695J34938_10334700 | 3300002450 | Bacteria | 662 |
| 89 | Ga0074263_117114 | 3300005485 | Unclassified | 2800 |
| 90 | Ga0466715_080105 | 3300042616 | Bacteria | 10394 |
| 91 | Ga0466715_101138 | 3300042616 | Bacteria | 6966 |
| 92 | Ga0466726_321538 | 3300042619 | Bacteria | 1777 |
| 93 | Ga0466731_326935 | 3300042622 | Bacteria | 2800 |
| 94 | Ga0466731_375119 | 3300042622 | Bacteria | 1029 |
| 95 | Ga0466735_022532 | 3300042624 | Unclassified | 1356 |
| 96 | Ga0466702_465483 | 3300042635 | Bacteria | 7908 |
| 97 | Ga0466703_149697 | 3300042636 | Unclassified | 2925 |
| 98 | Ga0466709_234115 | 3300042648 | Bacteria | 5108 |
| 99 | Ga0466709_291921 | 3300042648 | Bacteria | 6395 |
| 100 | Ga0466732_446997 | 3300042656 | Bacteria | 3367 |
| 101 | Ga0466733_165210 | 3300042659 | Bacteria | 6994 |
| 102 | Ga0123353_11154841 | 3300010167 | Bacteria | 1022 |
| 103 | Ga0223685_1003085 | 3300021229 | Bacteria | 660 |
| 104 | JGI24698J34947_10021064 | 3300002449 | Bacteria | 3510 |
| 105 | JGI24695J34938_10004411 | 3300002450 | Bacteria | 9250 |
| 106 | Ga0072941_1071501 | 3300005201 | Bacteria | 1930 |
| 107 | Ga0466712_280940 | 3300042614 | Bacteria | 1297 |
| 108 | Ga0466706_060969 | 3300042599 | Bacteria | 94525 |
| 109 | Ga0466716_263923 | 3300042605 | Bacteria | 1438 |
| 110 | Ga0466735_205935 | 3300042624 | Bacteria | 2035 |
| 111 | Ga0466704_538628 | 3300042643 | Bacteria | 4495 |
| 112 | Ga0466709_197515 | 3300042648 | Bacteria | 7837 |
| 113 | Ga0123357_10275998 | 3300009784 | Bacteria | 1746 |
| 114 | Ga0123356_10003143 | 3300010049 | Bacteria | 17393 |
| 115 | Ga0123356_11219425 | 3300010049 | Bacteria | 918 |
| 116 | Ga0123353_10022677 | 3300010167 | Bacteria | 9475 |
| 117 | Ga0123353_10221823 | 3300010167 | Bacteria | 2955 |
| 118 | Ga0123353_11479953 | 3300010167 | Bacteria | 866 |
| 119 | Ga0123353_12286209 | 3300010167 | Bacteria | 651 |
| 120 | Ga0466718_063772 | 3300042617 | Bacteria | 2292 |
| 121 | Ga0466707_293971 | 3300042601 | Bacteria | 1112 |
| 122 | Ga0466722_039390 | 3300042609 | Bacteria | 4646 |
| 123 | Ga0466708_045751 | 3300042652 | Bacteria | 23734 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.