Protein Family IF02965
Metagenome
Metatranscriptome
122
Members
37
Samples
122
Scaffolds
114.44
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_11183665|Ga0123356_111836652
- Length
- 125 aa
- Sequence
- VGRIGTAIWYIMSKLEYKGYYGSIEYSKEDDCLFGKVLGMPNNLISYEGNTAAELYTDFKDAIDTYLDYCSRNGIKPHKGYNGVLNIRIPSEIHSRIAIYAENHGTSINSFIRDSIERRLETAM*
Sample Types
Isolate
0.0%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
66.7%
Kalotermitidae
22.2%
Unclassified
5.6%
Termopsidae
2.8%
Rhinotermitidae
2.8%
Taxonomy
Archaea
0
Bacteria
81
Eukaryota
0
Viruses
1
Unclassified
40
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 2 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 3 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 4 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 5 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 6 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 7 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 8 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 9 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 10 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 22 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 23 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 26 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 34 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24702J35022_10021205 | 3300002462 | Bacteria | 3525 |
| 2 | JGI24705J35276_11931345 | 3300002504 | Unclassified | 777 |
| 3 | JGI24696J40584_12951855 | 3300002834 | Bacteria | 2284 |
| 4 | Ga0466726_081690 | 3300042619 | Bacteria | 8909 |
| 5 | Ga0466728_071926 | 3300042620 | Bacteria | 3199 |
| 6 | Ga0123354_10217728 | 3300010882 | Bacteria | 2040 |
| 7 | Ga0123354_10316556 | 3300010882 | Bacteria | 1448 |
| 8 | Ga0123354_10699567 | 3300010882 | Unclassified | 709 |
| 9 | Ga0466656_087221 | 3300042550 | Bacteria | 1465 |
| 10 | Ga0466691_023619 | 3300042593 | Bacteria | 14572 |
| 11 | Ga0466717_054997 | 3300042604 | Unclassified | 1360 |
| 12 | Ga0466717_267418 | 3300042604 | Bacteria | 1405 |
| 13 | Ga0466721_375256 | 3300042608 | Unclassified | 1078 |
| 14 | JGI24702J35022_10032376 | 3300002462 | Bacteria | 2800 |
| 15 | JGI24702J35022_10086667 | 3300002462 | Bacteria | 1700 |
| 16 | JGI24705J35276_12195100 | 3300002504 | Bacteria | 1521 |
| 17 | JGI24696J40584_12301155 | 3300002834 | Unclassified | 519 |
| 18 | Ga0123356_11608576 | 3300010049 | Bacteria | 804 |
| 19 | Ga0123356_12399593 | 3300010049 | Unclassified | 660 |
| 20 | Ga0123356_13319267 | 3300010049 | Unclassified | 559 |
| 21 | Ga0123353_11273741 | 3300010167 | Unclassified | 957 |
| 22 | Ga0123353_13206983 | 3300010167 | Bacteria | 524 |
| 23 | Ga0123354_10434380 | 3300010882 | Unclassified | 1078 |
| 24 | Ga0123354_10452415 | 3300010882 | Bacteria | 1039 |
| 25 | Ga0466657_351099 | 3300042582 | Bacteria | 2909 |
| 26 | Ga0466701_033956 | 3300042598 | Bacteria | 1351 |
| 27 | Ga0466697_067412 | 3300042611 | Bacteria | 1256 |
| 28 | Ga0068305_10060120 | 3300005083 | Bacteria | 9059 |
| 29 | Ga0123357_10120496 | 3300009784 | Bacteria | 3307 |
| 30 | Ga0123356_10185090 | 3300010049 | Bacteria | 2108 |
| 31 | Ga0123356_10333697 | 3300010049 | Bacteria | 1634 |
| 32 | Ga0123356_10351312 | 3300010049 | Bacteria | 1598 |
| 33 | Ga0123356_12348207 | 3300010049 | Unclassified | 667 |
| 34 | Ga0123356_13760623 | 3300010049 | Unclassified | 524 |
| 35 | Ga0123353_10402830 | 3300010167 | Unclassified | 2035 |
| 36 | Ga0123354_10096593 | 3300010882 | Bacteria | 4034 |
| 37 | Ga0123354_10098609 | 3300010882 | Bacteria | 3972 |
| 38 | Ga0123354_10420094 | 3300010882 | Unclassified | 1112 |
| 39 | Ga0123354_10422332 | 3300010882 | Bacteria | 1106 |
| 40 | Ga0466693_437687 | 3300042592 | Unclassified | 1879 |
| 41 | Ga0466703_128279 | 3300042636 | Bacteria | 1417 |
| 42 | Ga0466701_091676 | 3300042598 | Viruses | 1392 |
| 43 | Ga0466717_202126 | 3300042604 | Bacteria | 1777 |
| 44 | Ga0466722_116437 | 3300042609 | Bacteria | 5546 |
| 45 | Ga0466697_000342 | 3300042611 | Bacteria | 1222 |
| 46 | JGI24696J40584_12384074 | 3300002834 | Unclassified | 548 |
| 47 | Ga0123357_10015451 | 3300009784 | Unclassified | 10011 |
| 48 | Ga0123357_10036766 | 3300009784 | Bacteria | 6663 |
| 49 | Ga0123355_11810596 | 3300009826 | Unclassified | 575 |
| 50 | Ga0123356_10104753 | 3300010049 | Bacteria | 2720 |
| 51 | Ga0123356_10274836 | 3300010049 | Bacteria | 1776 |
| 52 | Ga0123356_10782197 | 3300010049 | Unclassified | 1125 |
| 53 | Ga0123353_10619396 | 3300010167 | Bacteria | 1541 |
| 54 | Ga0123354_10596083 | 3300010882 | Unclassified | 812 |
| 55 | Ga0466725_006323 | 3300042654 | Bacteria | 1059 |
| 56 | Ga0466721_261146 | 3300042608 | Bacteria | 1700 |
| 57 | Ga0466698_509011 | 3300042610 | Bacteria | 1458 |
| 58 | JGI24702J35022_10104781 | 3300002462 | Unclassified | 1551 |
| 59 | JGI24702J35022_10577524 | 3300002462 | Unclassified | 694 |
| 60 | JGI24696J40584_12527746 | 3300002834 | Unclassified | 613 |
| 61 | Ga0072941_1653220 | 3300005201 | Unclassified | 748 |
| 62 | Ga0466728_025399 | 3300042620 | Bacteria | 1626 |
| 63 | Ga0123357_10057135 | 3300009784 | Bacteria | 5244 |
| 64 | Ga0123357_10595122 | 3300009784 | Unclassified | 853 |
| 65 | Ga0123356_10537964 | 3300010049 | Bacteria | 1328 |
| 66 | Ga0123353_10793045 | 3300010167 | Bacteria | 1310 |
| 67 | Ga0123353_11150685 | 3300010167 | Unclassified | 1024 |
| 68 | Ga0123354_10288708 | 3300010882 | Bacteria | 1577 |
| 69 | Ga0466690_244027 | 3300042590 | Bacteria | 2483 |
| 70 | Ga0466694_044419 | 3300042594 | Bacteria | 1771 |
| 71 | Ga0466701_018265 | 3300042598 | Bacteria | 2005 |
| 72 | Ga0466717_128955 | 3300042604 | Unclassified | 1144 |
| 73 | Ga0466719_500221 | 3300042606 | Bacteria | 1527 |
| 74 | Ga0466698_310614 | 3300042610 | Bacteria | 2827 |
| 75 | Ga0466705_145679 | 3300042612 | Bacteria | 7696 |
| 76 | Ga0466733_096582 | 3300042659 | Bacteria | 1104 |
| 77 | JGI24702J35022_10020606 | 3300002462 | Bacteria | 3578 |
| 78 | JGI24702J35022_10567112 | 3300002462 | Bacteria | 700 |
| 79 | JGI24702J35022_10612821 | 3300002462 | Unclassified | 674 |
| 80 | JGI24699J35502_10995554 | 3300002509 | Bacteria | 1329 |
| 81 | Ga0123356_10734651 | 3300010049 | Unclassified | 1157 |
| 82 | Ga0123356_11023269 | 3300010049 | Bacteria | 996 |
| 83 | Ga0123356_11065759 | 3300010049 | Bacteria | 977 |
| 84 | Ga0123356_11183665 | 3300010049 | Unclassified | 931 |
| 85 | Ga0123356_12484191 | 3300010049 | Bacteria | 648 |
| 86 | Ga0123353_10410788 | 3300010167 | Bacteria | 2010 |
| 87 | Ga0123353_12330724 | 3300010167 | Unclassified | 643 |
| 88 | Ga0123354_10007441 | 3300010882 | Bacteria | 16489 |
| 89 | Ga0466691_211096 | 3300042593 | Bacteria | 1544 |
| 90 | Ga0466694_064660 | 3300042594 | Unclassified | 1032 |
| 91 | Ga0466734_042735 | 3300042623 | Bacteria | 1540 |
| 92 | Ga0466704_432525 | 3300042643 | Bacteria | 1172 |
| 93 | Ga0466721_388720 | 3300042608 | Bacteria | 12027 |
| 94 | JGI24702J35022_10701851 | 3300002462 | Bacteria | 629 |
| 95 | JGI24705J35276_12219063 | 3300002504 | Bacteria | 2182 |
| 96 | JGI24696J40584_12754303 | 3300002834 | Unclassified | 799 |
| 97 | JGI24696J40584_12938973 | 3300002834 | Bacteria | 1640 |
| 98 | Ga0466710_239766 | 3300042613 | Bacteria | 2245 |
| 99 | Ga0466715_439887 | 3300042616 | Bacteria | 8439 |
| 100 | Ga0123356_10065869 | 3300010049 | Bacteria | 3390 |
| 101 | Ga0123356_10708251 | 3300010049 | Unclassified | 1176 |
| 102 | Ga0123356_13820747 | 3300010049 | Unclassified | 520 |
| 103 | Ga0123354_10158978 | 3300010882 | Unclassified | 2694 |
| 104 | Ga0233288_1042229 | 3300022232 | Unclassified | 549 |
| 105 | Ga0466690_249598 | 3300042590 | Bacteria | 19509 |
| 106 | Ga0466693_440158 | 3300042592 | Bacteria | 1825 |
| 107 | Ga0466699_183843 | 3300042597 | Bacteria | 1528 |
| 108 | Ga0466699_437848 | 3300042597 | Bacteria | 3625 |
| 109 | Ga0466704_010996 | 3300042643 | Bacteria | 1416 |
| 110 | Ga0466713_048041 | 3300042602 | Unclassified | 2338 |
| 111 | Ga0466719_251144 | 3300042606 | Bacteria | 15388 |
| 112 | JGI24696J40584_12569801 | 3300002834 | Bacteria | 637 |
| 113 | Ga0072941_1072125 | 3300005201 | Bacteria | 5135 |
| 114 | Ga0466710_023616 | 3300042613 | Unclassified | 1332 |
| 115 | Ga0123357_10896268 | 3300009784 | Unclassified | 574 |
| 116 | Ga0123355_10003071 | 3300009826 | Bacteria | 23795 |
| 117 | Ga0123356_11045372 | 3300010049 | Bacteria | 986 |
| 118 | Ga0123353_11889573 | 3300010167 | Bacteria | 737 |
| 119 | Ga0123354_10595389 | 3300010882 | Unclassified | 813 |
| 120 | Ga0466725_040786 | 3300042654 | Bacteria | 23793 |
| 121 | Ga0466725_157296 | 3300042654 | Bacteria | 1362 |
| 122 | Ga0466698_270689 | 3300042610 | Bacteria | 1703 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05534 | HicB | HicB family | 66 | 114 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.