Protein Family IF02922
Metagenome
Isolate
112
Members
39
Samples
111
Scaffolds
108.42
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10480788|Ga0123356_104807881
- Length
- 121 aa
- Sequence
- MPILILFTINKDTGVDKIETGNIVLLKFPFTDGISYKRRPALILKDFEDGDLLVCRITSKIYKSKYDIFLDDWLKFGLKLPSVVRVHKMATLEKDMVETIMGQIDETVLSKVKLLYLSIF*
Sample Types
Isolate
0.9%
Metagenome
99.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
71.1%
Unclassified
10.5%
Kalotermitidae
7.9%
Rhinotermitidae
2.6%
Hodotermitidae
2.6%
Passalidae
2.6%
Termopsidae
2.6%
Taxonomy
Archaea
0
Bacteria
104
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 23 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 24 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 29 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 30 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 31 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 32 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 33 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 36 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_204316 | 3300042611 | Bacteria | 2013 |
| 2 | Ga0466710_203957 | 3300042613 | Bacteria | 2713 |
| 3 | Ga0466726_063656 | 3300042619 | Bacteria | 1190 |
| 4 | Ga0123356_10905886 | 3300010049 | Bacteria | 1053 |
| 5 | Ga0123356_12316579 | 3300010049 | Bacteria | 672 |
| 6 | Ga0123353_10223088 | 3300010167 | Bacteria | 2945 |
| 7 | Ga0123353_10478165 | 3300010167 | Unclassified | 1824 |
| 8 | Ga0123353_11584716 | 3300010167 | Bacteria | 828 |
| 9 | Ga0123353_12296637 | 3300010167 | Bacteria | 649 |
| 10 | Ga0123354_10413184 | 3300010882 | Bacteria | 1129 |
| 11 | Ga0466695_333231 | 3300042595 | Bacteria | 1001 |
| 12 | Ga0466699_335849 | 3300042597 | Bacteria | 1927 |
| 13 | Ga0466725_053048 | 3300042654 | Bacteria | 2013 |
| 14 | Ga0466706_185973 | 3300042599 | Bacteria | 1415 |
| 15 | Ga0466719_105628 | 3300042606 | Bacteria | 1737 |
| 16 | JGI24698J34947_10250352 | 3300002449 | Bacteria | 662 |
| 17 | JGI24702J35022_10270138 | 3300002462 | Bacteria | 995 |
| 18 | JGI24702J35022_10815305 | 3300002462 | Bacteria | 581 |
| 19 | JGI24696J40584_12412621 | 3300002834 | Bacteria | 560 |
| 20 | JGI24696J40584_12878756 | 3300002834 | Bacteria | 1075 |
| 21 | JGI24696J40584_12898119 | 3300002834 | Bacteria | 1168 |
| 22 | Ga0466732_447361 | 3300042656 | Bacteria | 66921 |
| 23 | Ga0466711_272199 | 3300042615 | Bacteria | 3529 |
| 24 | Ga0123357_10008187 | 3300009784 | Bacteria | 13026 |
| 25 | Ga0123356_10373247 | 3300010049 | Bacteria | 1557 |
| 26 | Ga0123356_10417973 | 3300010049 | Bacteria | 1482 |
| 27 | Ga0123354_10053232 | 3300010882 | Bacteria | 6088 |
| 28 | Ga0123354_10305940 | 3300010882 | Bacteria | 1494 |
| 29 | Ga0466734_047651 | 3300042623 | Bacteria | 7509 |
| 30 | Ga0466703_267154 | 3300042636 | Bacteria | 1242 |
| 31 | Ga0466725_058735 | 3300042654 | Bacteria | 12398 |
| 32 | Ga0466700_425912 | 3300042600 | Bacteria | 4938 |
| 33 | IMNBGM34_c002047 | 3300000036 | Bacteria | 3083 |
| 34 | JGI24702J35022_10381532 | 3300002462 | Bacteria | 848 |
| 35 | JGI24702J35022_10984169 | 3300002462 | Bacteria | 525 |
| 36 | Ga0466732_026789 | 3300042656 | Bacteria | 2451 |
| 37 | Ga0466733_008891 | 3300042659 | Bacteria | 1493 |
| 38 | Ga0466711_161975 | 3300042615 | Bacteria | 14160 |
| 39 | Ga0123353_11040461 | 3300010167 | Bacteria | 1095 |
| 40 | Ga0466707_403051 | 3300042601 | Bacteria | 38545 |
| 41 | Ga0466717_016821 | 3300042604 | Unclassified | 1540 |
| 42 | Ga0466698_415193 | 3300042610 | Bacteria | 3224 |
| 43 | JGI24695J34938_10063772 | 3300002450 | Bacteria | 1561 |
| 44 | Ga0068305_10469579 | 3300005083 | Bacteria | 638 |
| 45 | Ga0466711_048569 | 3300042615 | Bacteria | 1062 |
| 46 | Ga0466718_118568 | 3300042617 | Bacteria | 1020 |
| 47 | Ga0123357_10074158 | 3300009784 | Bacteria | 4503 |
| 48 | Ga0123356_10198039 | 3300010049 | Bacteria | 2046 |
| 49 | Ga0123356_10283581 | 3300010049 | Bacteria | 1753 |
| 50 | Ga0123356_11065398 | 3300010049 | Bacteria | 977 |
| 51 | Ga0123353_11163719 | 3300010167 | Bacteria | 1016 |
| 52 | Ga0123353_11392735 | 3300010167 | Bacteria | 902 |
| 53 | Ga0123354_10649488 | 3300010882 | Bacteria | 754 |
| 54 | Ga0123354_10877134 | 3300010882 | Bacteria | 592 |
| 55 | Ga0466694_147065 | 3300042594 | Bacteria | 2186 |
| 56 | Ga0466725_466614 | 3300042654 | Unclassified | 1395 |
| 57 | JGI24695J34938_10131621 | 3300002450 | Bacteria | 1020 |
| 58 | JGI24696J40584_12733209 | 3300002834 | Bacteria | 773 |
| 59 | JGI24696J40584_12797604 | 3300002834 | Bacteria | 863 |
| 60 | JGI24696J40584_12904770 | 3300002834 | Unclassified | 1210 |
| 61 | Ga0466697_198597 | 3300042611 | Bacteria | 1691 |
| 62 | Ga0123356_10252464 | 3300010049 | Bacteria | 1842 |
| 63 | Ga0123356_10480788 | 3300010049 | Unclassified | 1395 |
| 64 | Ga0123353_10251991 | 3300010167 | Bacteria | 2733 |
| 65 | Ga0123353_10541675 | 3300010167 | Bacteria | 1682 |
| 66 | Ga0123353_10683045 | 3300010167 | Bacteria | 1445 |
| 67 | Ga0123354_10065737 | 3300010882 | Bacteria | 5305 |
| 68 | Ga0466701_043163 | 3300042598 | Bacteria | 2356 |
| 69 | JGI24702J35022_10073158 | 3300002462 | Bacteria | 1848 |
| 70 | JGI24696J40584_12634321 | 3300002834 | Bacteria | 681 |
| 71 | Ga0072940_1141643 | 3300005200 | Bacteria | 911 |
| 72 | Ga0466711_133262 | 3300042615 | Bacteria | 5793 |
| 73 | Ga0123357_10114830 | 3300009784 | Bacteria | 3416 |
| 74 | Ga0123356_10546927 | 3300010049 | Bacteria | 1318 |
| 75 | Ga0123356_11064994 | 3300010049 | Bacteria | 978 |
| 76 | Ga0123356_13023451 | 3300010049 | Bacteria | 587 |
| 77 | Ga0123353_10324052 | 3300010167 | Bacteria | 2336 |
| 78 | Ga0123353_10705158 | 3300010167 | Bacteria | 1415 |
| 79 | Ga0123353_11014619 | 3300010167 | Bacteria | 1113 |
| 80 | Ga0123353_11161983 | 3300010167 | Bacteria | 1017 |
| 81 | Ga0466694_096387 | 3300042594 | Bacteria | 1150 |
| 82 | Ga0466721_089368 | 3300042608 | Bacteria | 1002 |
| 83 | Ga0466697_055162 | 3300042611 | Bacteria | 1635 |
| 84 | JGI24702J35022_10020117 | 3300002462 | Bacteria | 3625 |
| 85 | JGI24705J35276_11680216 | 3300002504 | Bacteria | 624 |
| 86 | JGI24705J35276_12061941 | 3300002504 | Bacteria | 937 |
| 87 | Ga0466710_105535 | 3300042613 | Bacteria | 2893 |
| 88 | Ga0123356_10040838 | 3300010049 | Bacteria | 4322 |
| 89 | Ga0123356_10137025 | 3300010049 | Unclassified | 2408 |
| 90 | Ga0123356_10895100 | 3300010049 | Bacteria | 1059 |
| 91 | Ga0123353_10054360 | 3300010167 | Bacteria | 6403 |
| 92 | Ga0123353_10796714 | 3300010167 | Bacteria | 1305 |
| 93 | Ga0123354_10996822 | 3300010882 | Bacteria | 539 |
| 94 | Ga0466707_422975 | 3300042601 | Bacteria | 2964 |
| 95 | Ga0466713_047693 | 3300042602 | Bacteria | 1727 |
| 96 | JGI24705J35276_12117804 | 3300002504 | Bacteria | 1063 |
| 97 | JGI24696J40584_12886440 | 3300002834 | Bacteria | 1108 |
| 98 | Ga0466710_269720 | 3300042613 | Bacteria | 1978 |
| 99 | Ga0466729_017981 | 3300042621 | Bacteria | 1188 |
| 100 | Ga0123355_10002306 | 3300009826 | Bacteria | 26929 |
| 101 | Ga0123356_11569701 | 3300010049 | Bacteria | 814 |
| 102 | Ga0123353_11548705 | 3300010167 | Bacteria | 841 |
| 103 | Ga0415639_000237 | 3300038395 | Unclassified | 1466 |
| 104 | Ga0466694_399454 | 3300042594 | Bacteria | 1691 |
| 105 | Ga0466725_298501 | 3300042654 | Bacteria | 1066 |
| 106 | Ga0466725_426908 | 3300042654 | Bacteria | 1360 |
| 107 | Ga0466721_049347 | 3300042608 | Unclassified | 1044 |
| 108 | JGI24702J35022_10007073 | 3300002462 | Bacteria | 6449 |
| 109 | JGI24702J35022_10397691 | 3300002462 | Bacteria | 832 |
| 110 | JGI24705J35276_12224673 | 3300002504 | Bacteria | 2635 |
| 111 | Ga0072941_1051475 | 3300005201 | Bacteria | 577 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02452 | PemK_toxin | PemK-like, MazF-like toxin of type II toxin-antitoxin system | 20 | 113 | 0.87 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02452 | GO:0003677 | DNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.