Protein Family IF02912
Metagenome
Metatranscriptome
Isolate
112
Members
38
Samples
111
Scaffolds
153.11
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10404419|Ga0123356_104044193
- Length
- 171 aa
- Sequence
- MYLRRKRIELKKEDRTALERFSTTGVHSVRLVNRAKIILALDEAGSRLAEKQEVLAKRLGVSRQAVIDARDTFLELKSVPLFLQRKKRETPPVPPKVTGELEARIIALACGKAPEGYARWTLRLLAEKCVELQYVDTMSHMTISRLLKKRSSNRILKQAGASLRNKTALL*
Sample Types
Isolate
0.9%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.9%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
80.0%
Kalotermitidae
17.1%
Unclassified
2.9%
Taxonomy
Archaea
42
Bacteria
47
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300021237 | Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA | Metatranscriptome | |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 15 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 24 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 31 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 32 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 33 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 36 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10200232 | 3300010049 | Bacteria | 2036 |
| 2 | Ga0123356_10541584 | 3300010049 | Bacteria | 1324 |
| 3 | Ga0123353_12142307 | 3300010167 | Archaea | 679 |
| 4 | Ga0466701_054393 | 3300042598 | Unclassified | 2735 |
| 5 | AustNasuHG_c1017602 | 3300000089 | Bacteria | 2373 |
| 6 | JGI24698J34947_10030644 | 3300002449 | Bacteria | 2836 |
| 7 | JGI24695J34938_10052223 | 3300002450 | Bacteria | 1784 |
| 8 | Ga0466712_013866 | 3300042614 | Unclassified | 2313 |
| 9 | Ga0466718_126770 | 3300042617 | Archaea | 1104 |
| 10 | Ga0264413_118004 | 3300024493 | Archaea | 1240 |
| 11 | Ga0264413_118053 | 3300024493 | Archaea | 1038 |
| 12 | Ga0466693_203859 | 3300042592 | Archaea | 1175 |
| 13 | Ga0466695_371252 | 3300042595 | Bacteria | 1044 |
| 14 | Ga0466732_329651 | 3300042656 | Unclassified | 2209 |
| 15 | Ga0466732_420631 | 3300042656 | Bacteria | 5664 |
| 16 | Ga0466733_112078 | 3300042659 | Bacteria | 1404 |
| 17 | Ga0123357_10371372 | 3300009784 | Unclassified | 1340 |
| 18 | Ga0123356_10404419 | 3300010049 | Bacteria | 1503 |
| 19 | Ga0123356_11753143 | 3300010049 | Unclassified | 771 |
| 20 | Ga0123356_12957794 | 3300010049 | Archaea | 593 |
| 21 | Ga0466698_390166 | 3300042610 | Unclassified | 1027 |
| 22 | JGI24698J34947_10086325 | 3300002449 | Unclassified | 1455 |
| 23 | JGI24695J34938_10067040 | 3300002450 | Bacteria | 1511 |
| 24 | JGI24695J34938_10182964 | 3300002450 | Unclassified | 868 |
| 25 | JGI24702J35022_10251955 | 3300002462 | Archaea | 1027 |
| 26 | Ga0074263_137610 | 3300005485 | Archaea | 918 |
| 27 | Ga0074263_147326 | 3300005485 | Unclassified | 865 |
| 28 | Ga0466712_020059 | 3300042614 | Bacteria | 2315 |
| 29 | Ga0466718_048611 | 3300042617 | Bacteria | 1672 |
| 30 | Ga0415639_254111 | 3300038395 | Archaea | 1225 |
| 31 | Ga0123356_10047201 | 3300010049 | Archaea | 4006 |
| 32 | Ga0466701_027691 | 3300042598 | Bacteria | 1800 |
| 33 | Ga0466720_048185 | 3300042607 | Archaea | 1231 |
| 34 | Ga0466720_152380 | 3300042607 | Archaea | 1210 |
| 35 | Ga0466720_235541 | 3300042607 | Archaea | 1208 |
| 36 | Ga0466704_040085 | 3300042643 | Unclassified | 1437 |
| 37 | JGI24698J34947_10097678 | 3300002449 | Archaea | 1329 |
| 38 | JGI24695J34938_10279056 | 3300002450 | Bacteria | 716 |
| 39 | JGI24702J35022_10484241 | 3300002462 | Unclassified | 757 |
| 40 | Ga0466718_115518 | 3300042617 | Archaea | 1230 |
| 41 | Ga0466718_118582 | 3300042617 | Unclassified | 1321 |
| 42 | Ga0466694_009983 | 3300042594 | Archaea | 1722 |
| 43 | Ga0466732_115662 | 3300042656 | Bacteria | 3415 |
| 44 | Ga0123355_10354295 | 3300009826 | Bacteria | 1941 |
| 45 | Ga0123356_10255597 | 3300010049 | Bacteria | 1832 |
| 46 | Ga0123356_10501295 | 3300010049 | Unclassified | 1370 |
| 47 | Ga0123356_10676803 | 3300010049 | Bacteria | 1200 |
| 48 | Ga0123353_10609471 | 3300010167 | Archaea | 1558 |
| 49 | Ga0123353_11528214 | 3300010167 | Archaea | 848 |
| 50 | Ga0466700_332502 | 3300042600 | Bacteria | 1277 |
| 51 | Ga0466719_424502 | 3300042606 | Archaea | 1509 |
| 52 | Ga0466721_182320 | 3300042608 | Archaea | 1639 |
| 53 | Ga0466731_083968 | 3300042622 | Bacteria | 1795 |
| 54 | Ga0466731_095516 | 3300042622 | Archaea | 1632 |
| 55 | Ga0466731_141817 | 3300042622 | Archaea | 1508 |
| 56 | Ga0466702_068621 | 3300042635 | Archaea | 1478 |
| 57 | AustNasuHG_c1030414 | 3300000089 | Bacteria | 1554 |
| 58 | JGI24698J34947_10103398 | 3300002449 | Bacteria | 1274 |
| 59 | JGI24698J34947_10321194 | 3300002449 | Unclassified | 551 |
| 60 | Ga0223675_1000850 | 3300021237 | Archaea | 941 |
| 61 | Ga0264413_118003 | 3300024493 | Archaea | 1967 |
| 62 | Ga0466694_289328 | 3300042594 | Bacteria | 1802 |
| 63 | Ga0466695_171131 | 3300042595 | Unclassified | 3248 |
| 64 | Ga0466705_307869 | 3300042612 | Bacteria | 7992 |
| 65 | Ga0466732_046771 | 3300042656 | Unclassified | 1596 |
| 66 | Ga0123355_10672651 | 3300009826 | Archaea | 1199 |
| 67 | Ga0123356_12997492 | 3300010049 | Archaea | 589 |
| 68 | Ga0123356_13209823 | 3300010049 | Bacteria | 569 |
| 69 | Ga0466700_032168 | 3300042600 | Bacteria | 1621 |
| 70 | Ga0072940_1119816 | 3300005200 | Bacteria | 548 |
| 71 | Ga0466718_047590 | 3300042617 | Bacteria | 1623 |
| 72 | Ga0466718_135903 | 3300042617 | Bacteria | 1040 |
| 73 | Ga0415639_011515 | 3300038395 | Unclassified | 1300 |
| 74 | Ga0466693_273686 | 3300042592 | Unclassified | 1153 |
| 75 | Ga0466693_421184 | 3300042592 | Archaea | 1153 |
| 76 | Ga0123355_10476188 | 3300009826 | Bacteria | 1556 |
| 77 | Ga0123356_10502558 | 3300010049 | Bacteria | 1369 |
| 78 | Ga0123353_10702859 | 3300010167 | Unclassified | 1418 |
| 79 | Ga0123354_10308007 | 3300010882 | Bacteria | 1485 |
| 80 | Ga0466720_184379 | 3300042607 | Bacteria | 1511 |
| 81 | Ga0466702_191743 | 3300042635 | Bacteria | 1293 |
| 82 | Ga0466704_437800 | 3300042643 | Unclassified | 1628 |
| 83 | Ga0466723_141934 | 3300042618 | Bacteria | 1948 |
| 84 | Ga0466690_416451 | 3300042590 | Bacteria | 2679 |
| 85 | Ga0123355_10423775 | 3300009826 | Archaea | 1699 |
| 86 | Ga0123356_10360574 | 3300010049 | Archaea | 1580 |
| 87 | Ga0123356_10414043 | 3300010049 | Bacteria | 1488 |
| 88 | Ga0123356_12683539 | 3300010049 | Unclassified | 624 |
| 89 | Ga0466700_140732 | 3300042600 | Bacteria | 1340 |
| 90 | Ga0466700_365440 | 3300042600 | Bacteria | 1517 |
| 91 | Ga0466721_168255 | 3300042608 | Unclassified | 1481 |
| 92 | Ga0466731_009838 | 3300042622 | Archaea | 1000 |
| 93 | JGI24698J34947_10106693 | 3300002449 | Archaea | 1245 |
| 94 | JGI24695J34938_10069019 | 3300002450 | Bacteria | 1483 |
| 95 | JGI24699J35502_10775857 | 3300002509 | Unclassified | 848 |
| 96 | Ga0072940_1039435 | 3300005200 | Bacteria | 1558 |
| 97 | Ga0072941_1007835 | 3300005201 | Bacteria | 1129 |
| 98 | Ga0466718_095725 | 3300042617 | Archaea | 1024 |
| 99 | Ga0466693_105677 | 3300042592 | Archaea | 1896 |
| 100 | Ga0466699_366978 | 3300042597 | Bacteria | 1398 |
| 101 | Ga0123356_10952260 | 3300010049 | Archaea | 1029 |
| 102 | Ga0123356_12001833 | 3300010049 | Archaea | 722 |
| 103 | Ga0123353_10026736 | 3300010167 | Bacteria | 8822 |
| 104 | Ga0123353_10362967 | 3300010167 | Archaea | 2175 |
| 105 | Ga0123353_12401607 | 3300010167 | Archaea | 630 |
| 106 | Ga0466708_411345 | 3300042652 | Bacteria | 15474 |
| 107 | JGI24698J34947_10267296 | 3300002449 | Archaea | 631 |
| 108 | JGI24702J35022_10161095 | 3300002462 | Archaea | 1264 |
| 109 | Ga0072941_1009776 | 3300005201 | Archaea | 500 |
| 110 | Ga0466718_130656 | 3300042617 | Archaea | 1041 |
| 111 | Ga0466690_187301 | 3300042590 | Bacteria | 1811 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042592 | Ga0466693_203859 | Ga0466693_203859_587_1000 | 137 |
| 2 | 3300042595 | Ga0466695_171131 | Ga0466695_171131_1980_2396 | 138 |
| 3 | iso_pr_bacteria | 2781125641 | 2781289938 | 138 |
| 4 | 3300002449 | JGI24698J34947_10097678 | JGI24698J34947_100976782 | 139 |
| 5 | 3300010882 | Ga0123354_10308007 | Ga0123354_103080072 | 147 |
| 6 | 3300042622 | Ga0466731_009838 | Ga0466731_009838_316_759 | 147 |
| 7 | 3300042594 | Ga0466694_289328 | Ga0466694_289328_302_751 | 149 |
| 8 | 3300042590 | Ga0466690_187301 | Ga0466690_187301_1282_1737 | 151 |
| 9 | 3300042606 | Ga0466719_424502 | Ga0466719_424502_1009_1464 | 151 |
| 10 | 3300042612 | Ga0466705_307869 | Ga0466705_307869_694_1149 | 151 |
| 11 | 3300042643 | Ga0466704_040085 | Ga0466704_040085_515_970 | 151 |
| 12 | 3300042643 | Ga0466704_437800 | Ga0466704_437800_985_1440 | 151 |
| 13 | 3300042598 | Ga0466701_054393 | Ga0466701_054393_1625_2083 | 152 |
| 14 | 3300042656 | Ga0466732_046771 | Ga0466732_046771_861_1319 | 152 |
| 15 | 3300021237 | Ga0223675_1000850 | Ga0223675_10008502 | 153 |
| 16 | 3300024493 | Ga0264413_118003 | Ga0264413_1180033 | 153 |
| 17 | 3300024493 | Ga0264413_118004 | Ga0264413_1180041 | 153 |
| 18 | 3300024493 | Ga0264413_118053 | Ga0264413_1180532 | 153 |
| 19 | 3300038395 | Ga0415639_011515 | Ga0415639_011515_552_1013 | 153 |
| 20 | 3300038395 | Ga0415639_254111 | Ga0415639_254111_32_493 | 153 |
| 21 | 3300042592 | Ga0466693_105677 | Ga0466693_105677_233_694 | 153 |
| 22 | 3300042592 | Ga0466693_273686 | Ga0466693_273686_296_757 | 153 |
| 23 | 3300042592 | Ga0466693_421184 | Ga0466693_421184_94_555 | 153 |
| 24 | 3300042594 | Ga0466694_009983 | Ga0466694_009983_82_543 | 153 |
| 25 | 3300042595 | Ga0466695_371252 | Ga0466695_371252_270_731 | 153 |
| 26 | 3300042597 | Ga0466699_366978 | Ga0466699_366978_194_655 | 153 |
| 27 | 3300042598 | Ga0466701_027691 | Ga0466701_027691_1166_1627 | 153 |
| 28 | 3300042600 | Ga0466700_140732 | Ga0466700_140732_749_1210 | 153 |
| 29 | 3300042600 | Ga0466700_332502 | Ga0466700_332502_223_684 | 153 |
| 30 | 3300042600 | Ga0466700_365440 | Ga0466700_365440_319_780 | 153 |
| 31 | 3300042607 | Ga0466720_048185 | Ga0466720_048185_189_650 | 153 |
| 32 | 3300042607 | Ga0466720_152380 | Ga0466720_152380_561_1022 | 153 |
| 33 | 3300042607 | Ga0466720_184379 | Ga0466720_184379_156_617 | 153 |
| 34 | 3300042607 | Ga0466720_235541 | Ga0466720_235541_46_507 | 153 |
| 35 | 3300042608 | Ga0466721_182320 | Ga0466721_182320_133_594 | 153 |
| 36 | 3300042610 | Ga0466698_390166 | Ga0466698_390166_277_738 | 153 |
| 37 | 3300042614 | Ga0466712_013866 | Ga0466712_013866_75_536 | 153 |
| 38 | 3300042614 | Ga0466712_020059 | Ga0466712_020059_629_1090 | 153 |
| 39 | 3300042617 | Ga0466718_047590 | Ga0466718_047590_130_591 | 153 |
| 40 | 3300042617 | Ga0466718_048611 | Ga0466718_048611_87_548 | 153 |
| 41 | 3300042617 | Ga0466718_095725 | Ga0466718_095725_369_830 | 153 |
| 42 | 3300042617 | Ga0466718_115518 | Ga0466718_115518_66_527 | 153 |
| 43 | 3300042617 | Ga0466718_118582 | Ga0466718_118582_562_1023 | 153 |
| 44 | 3300042617 | Ga0466718_126770 | Ga0466718_126770_56_517 | 153 |
| 45 | 3300042617 | Ga0466718_130656 | Ga0466718_130656_459_920 | 153 |
| 46 | 3300042617 | Ga0466718_135903 | Ga0466718_135903_193_654 | 153 |
| 47 | 3300042622 | Ga0466731_095516 | Ga0466731_095516_955_1416 | 153 |
| 48 | 3300042622 | Ga0466731_141817 | Ga0466731_141817_211_672 | 153 |
| 49 | 3300042635 | Ga0466702_068621 | Ga0466702_068621_314_775 | 153 |
| 50 | 3300042635 | Ga0466702_191743 | Ga0466702_191743_281_742 | 153 |
| 51 | 3300042656 | Ga0466732_115662 | Ga0466732_115662_2458_2919 | 153 |
| 52 | 3300042656 | Ga0466732_329651 | Ga0466732_329651_923_1384 | 153 |
| 53 | 3300042656 | Ga0466732_420631 | Ga0466732_420631_4419_4880 | 153 |
| 54 | 3300042659 | Ga0466733_112078 | Ga0466733_112078_173_634 | 153 |
| 55 | 3300000089 | AustNasuHG_c1017602 | AustNasuHG_10176022 | 154 |
| 56 | 3300000089 | AustNasuHG_c1030414 | AustNasuHG_10304142 | 154 |
| 57 | 3300002449 | JGI24698J34947_10030644 | JGI24698J34947_100306443 | 154 |
| 58 | 3300002449 | JGI24698J34947_10086325 | JGI24698J34947_100863251 | 154 |
| 59 | 3300002449 | JGI24698J34947_10103398 | JGI24698J34947_101033982 | 154 |
| 60 | 3300002449 | JGI24698J34947_10106693 | JGI24698J34947_101066931 | 154 |
| 61 | 3300002449 | JGI24698J34947_10267296 | JGI24698J34947_102672961 | 154 |
| 62 | 3300002449 | JGI24698J34947_10321194 | JGI24698J34947_103211941 | 154 |
| 63 | 3300002450 | JGI24695J34938_10052223 | JGI24695J34938_100522231 | 154 |
| 64 | 3300002450 | JGI24695J34938_10067040 | JGI24695J34938_100670403 | 154 |
| 65 | 3300002450 | JGI24695J34938_10069019 | JGI24695J34938_100690191 | 154 |
| 66 | 3300002450 | JGI24695J34938_10182964 | JGI24695J34938_101829641 | 154 |
| 67 | 3300002450 | JGI24695J34938_10279056 | JGI24695J34938_102790561 | 154 |
| 68 | 3300002462 | JGI24702J35022_10161095 | JGI24702J35022_101610952 | 154 |
| 69 | 3300002462 | JGI24702J35022_10251955 | JGI24702J35022_102519551 | 154 |
| 70 | 3300002462 | JGI24702J35022_10484241 | JGI24702J35022_104842412 | 154 |
| 71 | 3300002509 | JGI24699J35502_10775857 | JGI24699J35502_107758571 | 154 |
| 72 | 3300005200 | Ga0072940_1039435 | Ga0072940_10394352 | 154 |
| 73 | 3300005200 | Ga0072940_1119816 | Ga0072940_11198161 | 154 |
| 74 | 3300005201 | Ga0072941_1007835 | Ga0072941_10078352 | 154 |
| 75 | 3300005201 | Ga0072941_1009776 | Ga0072941_10097761 | 154 |
| 76 | 3300005485 | Ga0074263_137610 | Ga0074263_1376101 | 154 |
| 77 | 3300005485 | Ga0074263_147326 | Ga0074263_1473262 | 154 |
| 78 | 3300009784 | Ga0123357_10371372 | Ga0123357_103713721 | 154 |
| 79 | 3300009826 | Ga0123355_10423775 | Ga0123355_104237753 | 154 |
| 80 | 3300009826 | Ga0123355_10476188 | Ga0123355_104761882 | 154 |
| 81 | 3300009826 | Ga0123355_10672651 | Ga0123355_106726512 | 154 |
| 82 | 3300010049 | Ga0123356_10047201 | Ga0123356_100472013 | 154 |
| 83 | 3300010049 | Ga0123356_10200232 | Ga0123356_102002324 | 154 |
| 84 | 3300010049 | Ga0123356_10255597 | Ga0123356_102555973 | 154 |
| 85 | 3300010049 | Ga0123356_10414043 | Ga0123356_104140431 | 154 |
| 86 | 3300010049 | Ga0123356_10501295 | Ga0123356_105012952 | 154 |
| 87 | 3300010049 | Ga0123356_10676803 | Ga0123356_106768032 | 154 |
| 88 | 3300010049 | Ga0123356_11753143 | Ga0123356_117531432 | 154 |
| 89 | 3300010049 | Ga0123356_12001833 | Ga0123356_120018331 | 154 |
| 90 | 3300010049 | Ga0123356_12683539 | Ga0123356_126835391 | 154 |
| 91 | 3300010049 | Ga0123356_12957794 | Ga0123356_129577941 | 154 |
| 92 | 3300010049 | Ga0123356_12997492 | Ga0123356_129974921 | 154 |
| 93 | 3300010049 | Ga0123356_13209823 | Ga0123356_132098231 | 154 |
| 94 | 3300010167 | Ga0123353_10026736 | Ga0123353_100267363 | 154 |
| 95 | 3300010167 | Ga0123353_10362967 | Ga0123353_103629672 | 154 |
| 96 | 3300010167 | Ga0123353_10609471 | Ga0123353_106094711 | 154 |
| 97 | 3300010167 | Ga0123353_10702859 | Ga0123353_107028591 | 154 |
| 98 | 3300010167 | Ga0123353_11528214 | Ga0123353_115282142 | 154 |
| 99 | 3300010167 | Ga0123353_12142307 | Ga0123353_121423072 | 154 |
| 100 | 3300010167 | Ga0123353_12401607 | Ga0123353_124016071 | 154 |
| 101 | 3300010049 | Ga0123356_10541584 | Ga0123356_105415841 | 155 |
| 102 | 3300042590 | Ga0466690_416451 | Ga0466690_416451_1192_1659 | 155 |
| 103 | 3300042618 | Ga0466723_141934 | Ga0466723_141934_1229_1696 | 155 |
| 104 | 3300042622 | Ga0466731_083968 | Ga0466731_083968_173_640 | 155 |
| 105 | 3300042652 | Ga0466708_411345 | Ga0466708_411345_2660_3127 | 155 |
| 106 | 3300009826 | Ga0123355_10354295 | Ga0123355_103542952 | 156 |
| 107 | 3300010049 | Ga0123356_10360574 | Ga0123356_103605742 | 156 |
| 108 | 3300010049 | Ga0123356_10502558 | Ga0123356_105025582 | 156 |
| 109 | 3300010049 | Ga0123356_10952260 | Ga0123356_109522602 | 156 |
| 110 | 3300042608 | Ga0466721_168255 | Ga0466721_168255_877_1353 | 158 |
| 111 | 3300042600 | Ga0466700_032168 | Ga0466700_032168_806_1294 | 162 |
| 112 | 3300010049 | Ga0123356_10404419 | Ga0123356_104044193 | 171 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13565 | HTH_32 | Homeodomain-like domain | 87 | 147 | 0.83 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.53 | 0.63 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.