Protein Family IF02900

Metagenome Isolate
127 Members
48 Samples
101 Scaffolds
140.21 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10348575|Ga0123356_103485752
Length
155 aa
Sequence
MIIIRQDKKKREAVQLVQFLAGMKGEGKTRKLIDMANENAKTTDGHLVFIDDDKRHIFDLHRDIRFVEAGRGELANYRELIGFVLGILSQNSDIKHIYIDGINNILATDAVNNESLLKLKVRLDSLVKTEQVSFTISVHCERDGLPEEIKAALV*

📊 Sample Types

Isolate 20.5%
Metagenome 79.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 53.2%
Termitidae 29.8%
Kalotermitidae 8.5%
Termopsidae 4.3%
Passalidae 2.1%
Rhinotermitidae 2.1%

🌳 Taxonomy

Archaea 1
Bacteria 116
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
2 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
3 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
4 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
5 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
6 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
7 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
8 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
9 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
10 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
11 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
12 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
13 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
14 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
19 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
20 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
21 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
22 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
23 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
24 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
30 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
31 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
32 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
33 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
34 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
35 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
36 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
37 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
38 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
39 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
40 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
41 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
42 2820427814 Unclassified Firmicutes Lab288P3bin44 Isolate Unclassified
43 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
44 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
47 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
48 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10000046 3300009826 Bacteria 122862
2 Ga0123355_10002246 3300009826 Bacteria 27271
3 Ga0123355_10329662 3300009826 Bacteria 2047
4 Ga0123355_10548393 3300009826 Bacteria 1399
5 Ga0123356_11461474 3300010049 Bacteria 842
6 Ga0123353_10106701 3300010167 Bacteria 4513
7 Ga0123353_10123342 3300010167 Bacteria 4165
8 Ga0123353_10712654 3300010167 Bacteria 1406
9 Ga0123353_10942132 3300010167 Unclassified 1169
10 Ga0123353_11518461 3300010167 Bacteria 852
11 Ga0466700_065583 3300042600 Bacteria 1525
12 Ga0415639_063865 3300038395 Bacteria 10835
13 Ga0415639_151792 3300038395 Bacteria 1186
14 JGI24703J35330_11748779 3300002501 Bacteria 34900
15 Ga0123355_10001027 3300009826 Bacteria 38735
16 Ga0123355_10001681 3300009826 Bacteria 30814
17 Ga0123355_10033445 3300009826 Bacteria 8352
18 Ga0123355_10853605 3300009826 Unclassified 1001
19 Ga0123355_11066772 3300009826 Bacteria 846
20 Ga0123353_10193547 3300010167 Bacteria 3207
21 Ga0123353_10473443 3300010167 Bacteria 1835
22 Ga0123354_10361095 3300010882 Bacteria 1280
23 Ga0466700_464826 3300042600 Bacteria 6401
24 Ga0466714_095004 3300042603 Bacteria 3110
25 Ga0415639_011580 3300038395 Bacteria 11307
26 Ga0466693_266101 3300042592 Bacteria 1162
27 Ga0466727_045560 3300042655 Bacteria 2491
28 Ga0123355_10090200 3300009826 Unclassified 4863
29 Ga0123355_10132655 3300009826 Bacteria 3833
30 Ga0123355_10168334 3300009826 Bacteria 3282
31 Ga0123355_10312769 3300009826 Bacteria 2126
32 Ga0123355_10747012 3300009826 Bacteria 1107
33 Ga0123353_11211968 3300010167 Bacteria 989
34 Ga0123354_10042509 3300010882 Unclassified 7003
35 Ga0466693_045447 3300042592 Bacteria 1179
36 Ga0466693_166558 3300042592 Bacteria 1123
37 IMNBL1DRAFT_c0001710 3300000062 Bacteria 16138
38 JGI24703J35330_11727492 3300002501 Bacteria 2587
39 JGI24703J35330_11748037 3300002501 Bacteria 10088
40 Ga0466735_105399 3300042624 Bacteria 1650
41 Ga0123356_10348575 3300010049 Bacteria 1604
42 Ga0123353_10014769 3300010167 Bacteria 11285
43 Ga0123353_10313093 3300010167 Archaea 2387
44 Ga0123353_10615238 3300010167 Bacteria 1548
45 Ga0123353_11657020 3300010167 Bacteria 804
46 Ga0466693_323731 3300042592 Bacteria 1664
47 Ga0072941_1227244 3300005201 Bacteria 4820
48 Ga0466711_233281 3300042615 Unclassified 5138
49 Ga0123355_10011240 3300009826 Bacteria 13782
50 Ga0123355_10253153 3300009826 Bacteria 2475
51 Ga0123355_10436260 3300009826 Bacteria 1662
52 Ga0123355_11024014 3300009826 Bacteria 873
53 Ga0123356_10078705 3300010049 Unclassified 3112
54 Ga0466719_283099 3300042606 Bacteria 1131
55 Ga0466722_266336 3300042609 Bacteria 1594
56 Ga0415639_224099 3300038395 Bacteria 1713
57 Ga0466693_237133 3300042592 Unclassified 1245
58 JGI24695J34938_10000127 3300002450 Bacteria 68233
59 JGI24703J35330_11748241 3300002501 Bacteria 12427
60 Ga0466715_353476 3300042616 Bacteria 47337
61 Ga0466715_555485 3300042616 Bacteria 11434
62 Ga0123357_10210803 3300009784 Bacteria 2183
63 Ga0123355_10508720 3300009826 Bacteria 1481
64 Ga0123355_10726487 3300009826 Bacteria 1131
65 Ga0123356_13685917 3300010049 Bacteria 530
66 Ga0123353_10085162 3300010167 Bacteria 5090
67 Ga0466700_411023 3300042600 Bacteria 1075
68 Ga0466721_387792 3300042608 Bacteria 2181
69 Ga0415639_023397 3300038395 Bacteria 19409
70 Ga0415639_244983 3300038395 Bacteria 1312
71 Ga0466699_308403 3300042597 Bacteria 1529
72 IMNBL1DRAFT_c0111913 3300000062 Bacteria 724
73 JGI24702J35022_10035060 3300002462 Bacteria 2683
74 Ga0072941_1003805 3300005201 Bacteria 76298
75 Ga0466705_514543 3300042612 Bacteria 5210
76 Ga0466715_027106 3300042616 Bacteria 2937
77 Ga0123355_10001255 3300009826 Bacteria 35410
78 Ga0123355_10006851 3300009826 Bacteria 16963
79 Ga0123355_10011651 3300009826 Bacteria 13568
80 Ga0123355_10015141 3300009826 Bacteria 12105
81 Ga0123355_10130551 3300009826 Bacteria 3872
82 Ga0123355_10202290 3300009826 Bacteria 2898
83 Ga0123355_10263659 3300009826 Bacteria 2405
84 Ga0123355_10804967 3300009826 Bacteria 1047
85 Ga0123355_11228938 3300009826 Bacteria 761
86 Ga0123354_10165884 3300010882 Bacteria 2596
87 Ga0415639_036228 3300038395 Bacteria 4166
88 IMNBL1DRAFT_c0001630 3300000062 Bacteria 16615
89 JGI24695J34938_10032019 3300002450 Bacteria 2433
90 Ga0466715_088026 3300042616 Unclassified 9296
91 Ga0123355_10000279 3300009826 Bacteria 65611
92 Ga0123355_10001527 3300009826 Bacteria 32307
93 Ga0123355_10080107 3300009826 Bacteria 5214
94 Ga0123355_10301940 3300009826 Unclassified 2181
95 Ga0123353_10778692 3300010167 Bacteria 1326
96 Ga0123354_10105614 3300010882 Bacteria 3767
97 Ga0466700_458025 3300042600 Bacteria 1060
98 Ga0415639_005842 3300038395 Bacteria 18336
99 Ga0415639_023567 3300038395 Bacteria 4952
100 JGI24695J34938_10108035 3300002450 Bacteria 1134
101 JGI24703J35330_11748292 3300002501 Unclassified 13355

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042624 Ga0466735_105399 Ga0466735_105399_809_1225 128
2 3300038395 Ga0415639_005842 Ga0415639_005842_1094_1492 132
3 3300038395 Ga0415639_036228 Ga0415639_036228_1400_1798 132
4 3300038395 Ga0415639_151792 Ga0415639_151792_282_680 132
5 3300042600 Ga0466700_464826 Ga0466700_464826_4307_4705 132
6 3300010049 Ga0123356_10078705 Ga0123356_100787054 133
7 3300010167 Ga0123353_10942132 Ga0123353_109421322 133
8 3300009826 Ga0123355_10080107 Ga0123355_100801072 134
9 3300009826 Ga0123355_10202290 Ga0123355_102022902 134
10 3300009826 Ga0123355_10548393 Ga0123355_105483931 135
11 3300038395 Ga0415639_023567 Ga0415639_023567_4330_4737 135
12 3300038395 Ga0415639_244983 Ga0415639_244983_450_857 135
13 3300042592 Ga0466693_045447 Ga0466693_045447_306_713 135
14 3300042592 Ga0466693_166558 Ga0466693_166558_19_426 135
15 3300042592 Ga0466693_237133 Ga0466693_237133_252_659 135
16 3300009826 Ga0123355_10090200 Ga0123355_100902002 136
17 3300009826 Ga0123355_10747012 Ga0123355_107470122 136
18 3300009826 Ga0123355_10804967 Ga0123355_108049672 136
19 3300009826 Ga0123355_10508720 Ga0123355_105087202 137
20 3300038395 Ga0415639_011580 Ga0415639_011580_2899_3312 137
21 3300042603 Ga0466714_095004 Ga0466714_095004_1313_1726 137
22 iso_pr_bacteria 2820427814 2820428029 137
23 iso_pr_bacteria 2820495292 2820496800 137
24 iso_pr_bacteria 2820627938 2820628437 137
25 iso_pr_bacteria 2820673891 2820674293 137
26 iso_pr_bacteria 2820698910 2820701169 137
27 3300000062 IMNBL1DRAFT_c0001630 IMNBL1DRAFT_000163011 138
28 3300000062 IMNBL1DRAFT_c0001710 IMNBL1DRAFT_00017105 138
29 3300000062 IMNBL1DRAFT_c0111913 IMNBL1DRAFT_01119132 138
30 3300002450 JGI24695J34938_10000127 JGI24695J34938_1000012754 138
31 3300005201 Ga0072941_1227244 Ga0072941_12272442 138
32 3300009784 Ga0123357_10210803 Ga0123357_102108032 138
33 3300009826 Ga0123355_10000046 Ga0123355_1000004674 138
34 3300009826 Ga0123355_10011240 Ga0123355_1001124015 138
35 3300009826 Ga0123355_10011651 Ga0123355_1001165112 138
36 3300009826 Ga0123355_10130551 Ga0123355_101305514 138
37 3300009826 Ga0123355_10168334 Ga0123355_101683341 138
38 3300010167 Ga0123353_10014769 Ga0123353_100147699 138
39 3300010167 Ga0123353_10085162 Ga0123353_100851622 138
40 3300010167 Ga0123353_10106701 Ga0123353_101067013 138
41 3300010167 Ga0123353_10193547 Ga0123353_101935473 138
42 3300010167 Ga0123353_10473443 Ga0123353_104734432 138
43 3300010167 Ga0123353_10615238 Ga0123353_106152382 138
44 3300010167 Ga0123353_10712654 Ga0123353_107126542 138
45 3300010167 Ga0123353_11211968 Ga0123353_112119682 138
46 3300010882 Ga0123354_10165884 Ga0123354_101658843 138
47 3300038395 Ga0415639_023397 Ga0415639_023397_3211_3627 138
48 3300038395 Ga0415639_063865 Ga0415639_063865_4132_4548 138
49 3300042600 Ga0466700_458025 Ga0466700_458025_146_562 138
50 3300042606 Ga0466719_283099 Ga0466719_283099_73_489 138
51 3300042616 Ga0466715_353476 Ga0466715_353476_11514_11930 138
52 iso_pr_bacteria 2820408893 2820409653 138
53 iso_pr_bacteria 2820435670 2820437434 138
54 iso_pr_bacteria 2820541116 2820542834 138
55 iso_pr_bacteria 2820644600 2820645561 138
56 3300002462 JGI24702J35022_10035060 JGI24702J35022_100350601 139
57 3300009826 Ga0123355_10253153 Ga0123355_102531532 139
58 3300009826 Ga0123355_10301940 Ga0123355_103019402 139
59 3300009826 Ga0123355_10726487 Ga0123355_107264872 139
60 3300010049 Ga0123356_13685917 Ga0123356_136859171 139
61 3300010167 Ga0123353_10123342 Ga0123353_101233423 139
62 3300010882 Ga0123354_10042509 Ga0123354_100425098 139
63 3300038395 Ga0415639_224099 Ga0415639_224099_192_611 139
64 3300042592 Ga0466693_266101 Ga0466693_266101_548_967 139
65 3300042600 Ga0466700_411023 Ga0466700_411023_338_757 139
66 3300042608 Ga0466721_387792 Ga0466721_387792_767_1186 139
67 iso_pr_bacteria 2820285501 2820288429 139
68 iso_pr_bacteria 2820375548 2820376975 139
69 iso_pr_bacteria 2820375548 2820377500 139
70 iso_pr_bacteria 2820378768 2820378811 139
71 iso_pr_bacteria 2820382897 2820383417 139
72 iso_pr_bacteria 2820385248 2820387395 139
73 iso_pr_bacteria 2820522177 2820522421 139
74 iso_pr_bacteria 2820581541 2820582661 139
75 iso_pr_bacteria 2820607737 2820607901 139
76 iso_pr_bacteria 2820630457 2820631521 139
77 iso_pr_bacteria 2820693137 2820696169 139
78 iso_pr_bacteria 2820702360 2820703021 139
79 3300002450 JGI24695J34938_10032019 JGI24695J34938_100320192 140
80 3300002450 JGI24695J34938_10108035 JGI24695J34938_101080352 140
81 3300002501 JGI24703J35330_11727492 JGI24703J35330_117274922 140
82 3300002501 JGI24703J35330_11748037 JGI24703J35330_117480377 140
83 3300002501 JGI24703J35330_11748241 JGI24703J35330_117482418 140
84 3300002501 JGI24703J35330_11748292 JGI24703J35330_117482928 140
85 3300002501 JGI24703J35330_11748779 JGI24703J35330_1174877939 140
86 3300009826 Ga0123355_10001527 Ga0123355_1000152722 140
87 3300009826 Ga0123355_10001681 Ga0123355_100016813 140
88 3300010049 Ga0123356_11461474 Ga0123356_114614741 140
89 3300042597 Ga0466699_308403 Ga0466699_308403_537_959 140
90 3300042616 Ga0466715_555485 Ga0466715_555485_8109_8531 140
91 iso_pr_bacteria 2820596822 2820597399 141
92 3300005201 Ga0072941_1003805 Ga0072941_100380566 142
93 3300009826 Ga0123355_10001255 Ga0123355_1000125530 142
94 iso_pr_bacteria 2820654856 2820655578 142
95 3300009826 Ga0123355_10001027 Ga0123355_1000102727 143
96 3300009826 Ga0123355_10002246 Ga0123355_1000224612 143
97 3300009826 Ga0123355_10015141 Ga0123355_100151414 143
98 3300009826 Ga0123355_10033445 Ga0123355_100334455 143
99 3300009826 Ga0123355_10132655 Ga0123355_101326552 143
100 3300009826 Ga0123355_10263659 Ga0123355_102636592 143
101 3300009826 Ga0123355_10329662 Ga0123355_103296622 143
102 3300009826 Ga0123355_10436260 Ga0123355_104362602 143
103 3300009826 Ga0123355_10853605 Ga0123355_108536052 143
104 3300009826 Ga0123355_11066772 Ga0123355_110667722 143
105 3300009826 Ga0123355_11228938 Ga0123355_112289382 143
106 3300010882 Ga0123354_10105614 Ga0123354_101056144 143
107 3300010882 Ga0123354_10361095 Ga0123354_103610952 143
108 3300009826 Ga0123355_10006851 Ga0123355_100068514 144
109 3300009826 Ga0123355_10312769 Ga0123355_103127692 145
110 3300042612 Ga0466705_514543 Ga0466705_514543_4362_4799 145
111 3300042655 Ga0466727_045560 Ga0466727_045560_815_1252 145
112 iso_pr_bacteria 2820472365 2820474256 145
113 3300009826 Ga0123355_11024014 Ga0123355_110240142 146
114 iso_pr_bacteria 2820513949 2820515860 146
115 iso_pr_bacteria 2820623020 2820623922 146
116 3300009826 Ga0123355_10000279 Ga0123355_1000027939 147
117 3300010167 Ga0123353_11657020 Ga0123353_116570201 148
118 3300042600 Ga0466700_065583 Ga0466700_065583_352_804 150
119 3300010167 Ga0123353_10313093 Ga0123353_103130932 151
120 3300010167 Ga0123353_10778692 Ga0123353_107786922 152
121 3300042616 Ga0466715_088026 Ga0466715_088026_21_479 152
122 3300010049 Ga0123356_10348575 Ga0123356_103485752 155
123 3300010167 Ga0123353_11518461 Ga0123353_115184611 155
124 3300042615 Ga0466711_233281 Ga0466711_233281_2688_3155 155
125 3300042616 Ga0466715_027106 Ga0466715_027106_1748_2215 155
126 3300042592 Ga0466693_323731 Ga0466693_323731_1108_1581 157
127 3300042609 Ga0466722_266336 Ga0466722_266336_905_1384 159

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.