Protein Family IF02893
Metagenome
Isolate
110
Members
50
Samples
100
Scaffolds
164.17
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10326720|Ga0123356_103267202
- Length
- 194 aa
- Sequence
- MVLILSMHGLQSPYKCVIILTENMGGMHMPKRQSYISWDEYFMGIALLSAYRSKDPRTQVGACIVNGSNRIMSMGYNGLPAGCGDDEFPWEAEGEYLDTKYPYVCHAELNAILNSGGRSLEGCKIYVALFPCNECAKAIIQCGIKEVLYLSDKYAGTPGNQASKRLFAAAGVAMTQLTLGRGSITIDFDPAKV*
Sample Types
Isolate
9.1%
Metagenome
90.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
52.1%
Unclassified
16.7%
Kalotermitidae
10.4%
Rhinotermitidae
6.2%
Blattidae
6.2%
Passalidae
6.2%
Termopsidae
2.1%
Taxonomy
Archaea
0
Bacteria
101
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 12 | 2820056190 | Unclassified Proteobacteria Nt197P4bin9 | Isolate | Unclassified |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 19 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 20 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 23 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 24 | 2820080004 | Unclassified Proteobacteria Lab288P4bin34 | Isolate | Unclassified |
| 25 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 29 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 30 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 33 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 34 | 2820101058 | Unclassified Proteobacteria Emb289P4bin76 | Isolate | Unclassified |
| 35 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 39 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 40 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 41 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 42 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 43 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 44 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 45 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 46 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 47 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 48 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 49 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 50 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_136284 | 3300042659 | Bacteria | 8328 |
| 2 | Ga0123357_10126225 | 3300009784 | Unclassified | 3204 |
| 3 | Ga0123355_11052385 | 3300009826 | Bacteria | 855 |
| 4 | Ga0123356_10033881 | 3300010049 | Bacteria | 4777 |
| 5 | Ga0123353_10025393 | 3300010167 | Bacteria | 9028 |
| 6 | Ga0123353_10049613 | 3300010167 | Bacteria | 6687 |
| 7 | Ga0123353_10152950 | 3300010167 | Bacteria | 3681 |
| 8 | Ga0123353_10172647 | 3300010167 | Bacteria | 3430 |
| 9 | Ga0466720_149003 | 3300042607 | Bacteria | 3582 |
| 10 | JGI24702J35022_10016368 | 3300002462 | Bacteria | 4065 |
| 11 | JGI24696J40584_12948642 | 3300002834 | Unclassified | 2017 |
| 12 | JGI24696J40584_12955433 | 3300002834 | Bacteria | 2833 |
| 13 | Ga0466703_079286 | 3300042636 | Bacteria | 5052 |
| 14 | Ga0466732_070736 | 3300042656 | Bacteria | 1982 |
| 15 | Ga0123357_10210109 | 3300009784 | Bacteria | 2189 |
| 16 | Ga0123353_11072825 | 3300010167 | Unclassified | 1073 |
| 17 | Ga0466699_294816 | 3300042597 | Bacteria | 1639 |
| 18 | JGI24695J34938_10062312 | 3300002450 | Bacteria | 1585 |
| 19 | Ga0072941_1438651 | 3300005201 | Bacteria | 1098 |
| 20 | Ga0466731_367308 | 3300042622 | Bacteria | 3078 |
| 21 | Ga0123355_10013704 | 3300009826 | Bacteria | 12632 |
| 22 | Ga0123355_11571622 | 3300009826 | Bacteria | 636 |
| 23 | Ga0123356_10076587 | 3300010049 | Bacteria | 3153 |
| 24 | Ga0123353_10002918 | 3300010167 | Bacteria | 21408 |
| 25 | Ga0123353_10598590 | 3300010167 | Bacteria | 1576 |
| 26 | Ga0123353_11989846 | 3300010167 | Bacteria | 712 |
| 27 | Ga0123354_10014948 | 3300010882 | Bacteria | 12096 |
| 28 | Ga0466722_249094 | 3300042609 | Bacteria | 2708 |
| 29 | Ga0466698_503874 | 3300042610 | Bacteria | 45277 |
| 30 | JGI24702J35022_10178108 | 3300002462 | Unclassified | 1206 |
| 31 | Ga0466718_127121 | 3300042617 | Bacteria | 4503 |
| 32 | Ga0466729_271149 | 3300042621 | Bacteria | 100204 |
| 33 | Ga0466702_099185 | 3300042635 | Bacteria | 4493 |
| 34 | Ga0466703_080820 | 3300042636 | Bacteria | 1196 |
| 35 | Ga0123355_10780408 | 3300009826 | Bacteria | 1072 |
| 36 | Ga0123356_10002519 | 3300010049 | Bacteria | 19571 |
| 37 | Ga0123356_10492637 | 3300010049 | Bacteria | 1380 |
| 38 | Ga0123353_10070422 | 3300010167 | Bacteria | 5619 |
| 39 | Ga0123353_10080621 | 3300010167 | Bacteria | 5234 |
| 40 | Ga0466692_015366 | 3300042591 | Bacteria | 81401 |
| 41 | Ga0466707_350412 | 3300042601 | Bacteria | 1264 |
| 42 | Ga0466714_058082 | 3300042603 | Bacteria | 1503 |
| 43 | Ga0466722_237249 | 3300042609 | Bacteria | 156667 |
| 44 | Ga0466722_255621 | 3300042609 | Bacteria | 60979 |
| 45 | 2227013701 | 2225789003 | Bacteria | 5497 |
| 46 | 2227408567 | 2225789004 | Bacteria | 5731 |
| 47 | IMNBL1DRAFT_c0005520 | 3300000062 | Bacteria | 7208 |
| 48 | JGI24702J35022_10004475 | 3300002462 | Bacteria | 8295 |
| 49 | JGI24702J35022_10009175 | 3300002462 | Bacteria | 5565 |
| 50 | JGI24705J35276_12238274 | 3300002504 | Bacteria | 18399 |
| 51 | Ga0466710_332787 | 3300042613 | Bacteria | 1104 |
| 52 | Ga0466718_131016 | 3300042617 | Bacteria | 1983 |
| 53 | Ga0466734_085830 | 3300042623 | Bacteria | 1673 |
| 54 | Ga0466702_075792 | 3300042635 | Bacteria | 1282 |
| 55 | Ga0123355_10250355 | 3300009826 | Bacteria | 2495 |
| 56 | Ga0123354_10500113 | 3300010882 | Bacteria | 948 |
| 57 | Ga0123354_10521537 | 3300010882 | Bacteria | 913 |
| 58 | Ga0415639_154588 | 3300038395 | Bacteria | 1287 |
| 59 | Ga0466696_154758 | 3300042596 | Bacteria | 1622 |
| 60 | Ga0466714_109163 | 3300042603 | Bacteria | 1146 |
| 61 | Ga0466714_138063 | 3300042603 | Unclassified | 1682 |
| 62 | JGI24698J34947_10260643 | 3300002449 | Bacteria | 643 |
| 63 | JGI24696J40584_12818880 | 3300002834 | Bacteria | 903 |
| 64 | JGI24696J40584_12954199 | 3300002834 | Bacteria | 2598 |
| 65 | Ga0466726_137563 | 3300042619 | Bacteria | 1668 |
| 66 | Ga0466703_353416 | 3300042636 | Bacteria | 1803 |
| 67 | Ga0466733_084284 | 3300042659 | Bacteria | 1130 |
| 68 | Ga0123356_10054761 | 3300010049 | Bacteria | 3715 |
| 69 | Ga0123356_10326720 | 3300010049 | Bacteria | 1649 |
| 70 | Ga0123353_10000682 | 3300010167 | Bacteria | 41525 |
| 71 | Ga0123353_10000937 | 3300010167 | Bacteria | 35636 |
| 72 | Ga0123353_10002841 | 3300010167 | Bacteria | 21650 |
| 73 | Ga0123353_10101107 | 3300010167 | Bacteria | 4648 |
| 74 | Ga0123353_10938846 | 3300010167 | Bacteria | 1172 |
| 75 | Ga0466719_398712 | 3300042606 | Bacteria | 71100 |
| 76 | Ga0466698_403695 | 3300042610 | Bacteria | 5098 |
| 77 | JGI24702J35022_10368277 | 3300002462 | Bacteria | 862 |
| 78 | Ga0466715_551549 | 3300042616 | Bacteria | 80655 |
| 79 | Ga0123355_10034869 | 3300009826 | Bacteria | 8180 |
| 80 | Ga0123356_11478490 | 3300010049 | Bacteria | 838 |
| 81 | Ga0123353_10000076 | 3300010167 | Bacteria | 108569 |
| 82 | Ga0466714_164630 | 3300042603 | Unclassified | 2476 |
| 83 | Ga0466722_239200 | 3300042609 | Bacteria | 1569 |
| 84 | IMNBL1DRAFT_c0007602 | 3300000062 | Bacteria | 5667 |
| 85 | JGI24702J35022_10012806 | 3300002462 | Bacteria | 4653 |
| 86 | Ga0466712_088434 | 3300042614 | Bacteria | 1553 |
| 87 | Ga0466711_163818 | 3300042615 | Bacteria | 18116 |
| 88 | Ga0123356_10203969 | 3300010049 | Bacteria | 2020 |
| 89 | Ga0123356_10229331 | 3300010049 | Bacteria | 1920 |
| 90 | Ga0123356_11620655 | 3300010049 | Bacteria | 801 |
| 91 | Ga0123353_10005933 | 3300010167 | Bacteria | 16161 |
| 92 | Ga0123353_10080924 | 3300010167 | Unclassified | 5223 |
| 93 | Ga0123353_11446239 | 3300010167 | Bacteria | 880 |
| 94 | Ga0264413_153162 | 3300024493 | Unclassified | 6565 |
| 95 | Ga0466714_053604 | 3300042603 | Unclassified | 2068 |
| 96 | Ga0466717_270058 | 3300042604 | Bacteria | 2288 |
| 97 | Ga0466721_251509 | 3300042608 | Bacteria | 170691 |
| 98 | Ga0072941_1365288 | 3300005201 | Bacteria | 2109 |
| 99 | Ga0123357_10000925 | 3300009784 | Bacteria | 29848 |
| 100 | Ga0466726_307375 | 3300042619 | Bacteria | 1739 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.