Protein Family IF02865

Metagenome Isolate
109 Members
38 Samples
108 Scaffolds
207.66 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10226397|Ga0123356_102263972
Length
208 aa
Sequence
MEDILDVYTQKYDRNRILICMDEAPRQLIEETRIPIAMKPGKIARYDTEYKRNGTCEVFMFTAPLKGWRRAEITEKRTRIDWAVQIKKLLTVDFPEGEKIILVMDNLNTHTKGSLYQAFPPEEAKCYCDRIEIHYTPKHGSWLNMAEIEINVLVNHGLSKRVPTIEQMKKEVAAWNKSRNKTASKINWRFTTDDARIKLKRLYPLFD*

πŸ“Š Sample Types

Isolate 0.9%
Metagenome 99.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 73.7%
Kalotermitidae 13.2%
Passalidae 5.3%
Termopsidae 5.3%
Unclassified 2.6%

🌳 Taxonomy

Archaea 5
Bacteria 88
Eukaryota 0
Viruses 0
Unclassified 16

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
17 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
18 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
19 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
22 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
25 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
31 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
32 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
33 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
34 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_116332 3300042611 Bacteria 1748
2 Ga0123356_10225506 3300010049 Bacteria 1934
3 Ga0123354_10316925 3300010882 Bacteria 1446
4 Ga0466657_134947 3300042582 Bacteria 1329
5 Ga0466657_315145 3300042582 Bacteria 1109
6 Ga0466693_090119 3300042592 Unclassified 1304
7 Ga0466695_036267 3300042595 Unclassified 3812
8 Ga0466717_114582 3300042604 Bacteria 1436
9 Ga0466721_103405 3300042608 Bacteria 1529
10 Ga0466721_230725 3300042608 Bacteria 1696
11 Ga0466731_073846 3300042622 Bacteria 1503
12 Ga0466731_108202 3300042622 Bacteria 3041
13 Ga0466734_048603 3300042623 Unclassified 1585
14 Ga0466710_370074 3300042613 Bacteria 1513
15 Ga0123356_10138068 3300010049 Unclassified 2400
16 Ga0123353_10656095 3300010167 Bacteria 1484
17 Ga0466656_167375 3300042550 Bacteria 1748
18 Ga0466656_195047 3300042550 Bacteria 1516
19 Ga0466657_305055 3300042582 Bacteria 1828
20 Ga0466693_252218 3300042592 Bacteria 1619
21 Ga0466693_338200 3300042592 Unclassified 1398
22 Ga0466694_033841 3300042594 Bacteria 1404
23 Ga0466694_400267 3300042594 Bacteria 2344
24 Ga0466719_427802 3300042606 Bacteria 1382
25 Ga0466721_127957 3300042608 Bacteria 1413
26 Ga0466721_404494 3300042608 Bacteria 1131
27 2227495209 2225789004 Bacteria 3954
28 JGI24702J35022_10118649 3300002462 Bacteria 1460
29 JGI24705J35276_12171519 3300002504 Unclassified 1296
30 Ga0466697_244122 3300042611 Unclassified 1477
31 Ga0466710_252875 3300042613 Archaea 1198
32 Ga0123356_10498741 3300010049 Bacteria 1373
33 Ga0123354_10208836 3300010882 Bacteria 2118
34 Ga0123354_10292910 3300010882 Bacteria 1556
35 Ga0466694_065166 3300042594 Bacteria 1531
36 Ga0466701_020806 3300042598 Bacteria 1782
37 Ga0466700_195185 3300042600 Bacteria 2991
38 Ga0466734_055046 3300042623 Bacteria 1657
39 Ga0466734_089947 3300042623 Bacteria 1313
40 Ga0466703_183262 3300042636 Bacteria 1379
41 Ga0466704_227153 3300042643 Bacteria 1164
42 Ga0466709_100833 3300042648 Bacteria 15068
43 Ga0466710_188364 3300042613 Bacteria 2660
44 Ga0466710_359409 3300042613 Unclassified 1359
45 Ga0466712_314350 3300042614 Bacteria 1353
46 Ga0466726_291274 3300042619 Bacteria 1412
47 Ga0123356_10218159 3300010049 Archaea 1962
48 Ga0123356_10226397 3300010049 Bacteria 1931
49 Ga0123356_10355563 3300010049 Bacteria 1590
50 Ga0123354_10087877 3300010882 Bacteria 4329
51 Ga0123354_10331681 3300010882 Bacteria 1386
52 Ga0466700_210767 3300042600 Bacteria 1326
53 Ga0466721_256264 3300042608 Bacteria 1654
54 Ga0466721_270061 3300042608 Bacteria 1442
55 JGI24695J34938_10077544 3300002450 Bacteria 1378
56 JGI24702J35022_10459752 3300002462 Unclassified 776
57 Ga0123355_10251997 3300009826 Bacteria 2484
58 Ga0123353_10818168 3300010167 Bacteria 1283
59 Ga0123353_12543723 3300010167 Bacteria 608
60 Ga0466656_338192 3300042550 Bacteria 1718
61 Ga0466694_167016 3300042594 Archaea 1166
62 Ga0466699_057445 3300042597 Bacteria 1382
63 Ga0466721_122487 3300042608 Unclassified 1205
64 IMNBGM34_c002267 3300000036 Bacteria 2864
65 Ga0466734_086889 3300042623 Bacteria 1766
66 Ga0466724_35810 3300042649 Bacteria 1329
67 Ga0466718_122209 3300042617 Bacteria 2333
68 Ga0466718_132344 3300042617 Bacteria 1230
69 Ga0123357_10185494 3300009784 Bacteria 2414
70 Ga0123356_10300909 3300010049 Bacteria 1709
71 Ga0123356_10385590 3300010049 Bacteria 1535
72 Ga0123353_10557488 3300010167 Bacteria 1651
73 Ga0123354_10331811 3300010882 Bacteria 1385
74 Ga0466656_160144 3300042550 Bacteria 1370
75 Ga0466657_399943 3300042582 Bacteria 1409
76 Ga0466699_096649 3300042597 Bacteria 1253
77 Ga0466701_081393 3300042598 Bacteria 1648
78 Ga0466700_370663 3300042600 Bacteria 1058
79 Ga0466717_104498 3300042604 Bacteria 1515
80 Ga0466721_034502 3300042608 Bacteria 1666
81 Ga0466698_474074 3300042610 Bacteria 3361
82 Ga0466697_017782 3300042611 Bacteria 1858
83 Ga0466697_032881 3300042611 Bacteria 1374
84 Ga0466731_094714 3300042622 Bacteria 1150
85 Ga0466734_088598 3300042623 Unclassified 1607
86 Ga0466734_117175 3300042623 Bacteria 1264
87 Ga0466734_165815 3300042623 Bacteria 1433
88 Ga0466725_183102 3300042654 Unclassified 1266
89 Ga0466727_028862 3300042655 Bacteria 6798
90 Ga0466711_219030 3300042615 Bacteria 1209
91 Ga0123356_10761306 3300010049 Unclassified 1139
92 Ga0466656_321340 3300042550 Archaea 1469
93 Ga0466657_383494 3300042582 Bacteria 3412
94 Ga0466693_041916 3300042592 Bacteria 1059
95 Ga0466695_064557 3300042595 Bacteria 1408
96 Ga0466717_080733 3300042604 Unclassified 1376
97 Ga0466717_294400 3300042604 Bacteria 1426
98 Ga0466697_179398 3300042611 Bacteria 1618
99 Ga0466711_013513 3300042615 Bacteria 1602
100 Ga0466718_007064 3300042617 Bacteria 3048
101 Ga0123356_10820432 3300010049 Bacteria 1101
102 Ga0123353_11859073 3300010167 Bacteria 745
103 Ga0466694_165265 3300042594 Unclassified 1865
104 Ga0466694_239613 3300042594 Bacteria 1388
105 Ga0466699_238780 3300042597 Bacteria 1373
106 JGI24702J35022_10123447 3300002462 Bacteria 1432
107 JGI24705J35276_12173622 3300002504 Unclassified 1311
108 JGI24696J40584_12914360 3300002834 Archaea 1284

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042617 Ga0466718_007064 Ga0466718_007064_711_1271 186
2 3300002462 JGI24702J35022_10459752 JGI24702J35022_104597521 187
3 3300042592 Ga0466693_041916 Ga0466693_041916_83_646 187
4 3300042595 Ga0466695_036267 Ga0466695_036267_82_645 187
5 3300010167 Ga0123353_12543723 Ga0123353_125437231 188
6 3300042654 Ga0466725_183102 Ga0466725_183102_518_1141 188
7 3300042611 Ga0466697_116332 Ga0466697_116332_667_1290 195
8 3300010882 Ga0123354_10292910 Ga0123354_102929103 196
9 3300042610 Ga0466698_474074 Ga0466698_474074_1409_2011 200
10 3300042608 Ga0466721_034502 Ga0466721_034502_735_1340 201
11 3300042550 Ga0466656_338192 Ga0466656_338192_108_725 205
12 3300042608 Ga0466721_122487 Ga0466721_122487_245_862 205
13 3300042622 Ga0466731_094714 Ga0466731_094714_21_638 205
14 2225789004 2227495209 2227971810 207
15 3300042550 Ga0466656_160144 Ga0466656_160144_105_728 207
16 3300042550 Ga0466656_167375 Ga0466656_167375_303_926 207
17 3300042550 Ga0466656_195047 Ga0466656_195047_758_1381 207
18 3300042550 Ga0466656_321340 Ga0466656_321340_64_687 207
19 3300042582 Ga0466657_134947 Ga0466657_134947_621_1244 207
20 3300042582 Ga0466657_305055 Ga0466657_305055_1069_1692 207
21 3300042582 Ga0466657_315145 Ga0466657_315145_351_974 207
22 3300042582 Ga0466657_383494 Ga0466657_383494_740_1363 207
23 3300042582 Ga0466657_399943 Ga0466657_399943_149_772 207
24 3300042592 Ga0466693_090119 Ga0466693_090119_584_1207 207
25 3300042592 Ga0466693_252218 Ga0466693_252218_851_1474 207
26 3300042592 Ga0466693_338200 Ga0466693_338200_198_821 207
27 3300042594 Ga0466694_033841 Ga0466694_033841_108_731 207
28 3300042594 Ga0466694_065166 Ga0466694_065166_621_1244 207
29 3300042594 Ga0466694_165265 Ga0466694_165265_1180_1803 207
30 3300042594 Ga0466694_167016 Ga0466694_167016_207_830 207
31 3300042594 Ga0466694_239613 Ga0466694_239613_647_1270 207
32 3300042597 Ga0466699_057445 Ga0466699_057445_495_1118 207
33 3300042597 Ga0466699_096649 Ga0466699_096649_536_1159 207
34 3300042597 Ga0466699_238780 Ga0466699_238780_64_687 207
35 3300042600 Ga0466700_210767 Ga0466700_210767_13_636 207
36 3300042604 Ga0466717_080733 Ga0466717_080733_617_1240 207
37 3300042604 Ga0466717_104498 Ga0466717_104498_161_784 207
38 3300042604 Ga0466717_114582 Ga0466717_114582_99_722 207
39 3300042604 Ga0466717_294400 Ga0466717_294400_104_727 207
40 3300042606 Ga0466719_427802 Ga0466719_427802_109_732 207
41 3300042608 Ga0466721_103405 Ga0466721_103405_116_739 207
42 3300042608 Ga0466721_127957 Ga0466721_127957_94_717 207
43 3300042608 Ga0466721_230725 Ga0466721_230725_343_966 207
44 3300042608 Ga0466721_256264 Ga0466721_256264_587_1210 207
45 3300042608 Ga0466721_270061 Ga0466721_270061_755_1378 207
46 3300042608 Ga0466721_404494 Ga0466721_404494_384_1007 207
47 3300042611 Ga0466697_017782 Ga0466697_017782_299_922 207
48 3300042611 Ga0466697_032881 Ga0466697_032881_707_1330 207
49 3300042611 Ga0466697_179398 Ga0466697_179398_846_1469 207
50 3300042611 Ga0466697_244122 Ga0466697_244122_197_820 207
51 3300042613 Ga0466710_188364 Ga0466710_188364_1115_1738 207
52 3300042613 Ga0466710_252875 Ga0466710_252875_142_765 207
53 3300042613 Ga0466710_359409 Ga0466710_359409_661_1284 207
54 3300042613 Ga0466710_370074 Ga0466710_370074_206_829 207
55 3300042614 Ga0466712_314350 Ga0466712_314350_213_836 207
56 3300042615 Ga0466711_219030 Ga0466711_219030_576_1199 207
57 3300042617 Ga0466718_122209 Ga0466718_122209_1605_2228 207
58 3300042617 Ga0466718_132344 Ga0466718_132344_214_837 207
59 3300042622 Ga0466731_073846 Ga0466731_073846_154_777 207
60 3300042622 Ga0466731_108202 Ga0466731_108202_968_1591 207
61 3300042623 Ga0466734_048603 Ga0466734_048603_235_858 207
62 3300042623 Ga0466734_055046 Ga0466734_055046_76_699 207
63 3300042623 Ga0466734_086889 Ga0466734_086889_1000_1623 207
64 3300042623 Ga0466734_088598 Ga0466734_088598_762_1385 207
65 3300042623 Ga0466734_089947 Ga0466734_089947_602_1225 207
66 3300042623 Ga0466734_117175 Ga0466734_117175_620_1243 207
67 3300042623 Ga0466734_165815 Ga0466734_165815_648_1271 207
68 3300042636 Ga0466703_183262 Ga0466703_183262_31_654 207
69 3300042643 Ga0466704_227153 Ga0466704_227153_344_967 207
70 3300042648 Ga0466709_100833 Ga0466709_100833_1517_2140 207
71 3300042649 Ga0466724_35810 Ga0466724_35810_605_1228 207
72 iso_pr_bacteria 2820740053 2820741839 207
73 3300002450 JGI24695J34938_10077544 JGI24695J34938_100775441 208
74 3300002504 JGI24705J35276_12171519 JGI24705J35276_121715191 208
75 3300002504 JGI24705J35276_12173622 JGI24705J35276_121736221 208
76 3300002834 JGI24696J40584_12914360 JGI24696J40584_129143601 208
77 3300009784 Ga0123357_10185494 Ga0123357_101854942 208
78 3300009826 Ga0123355_10251997 Ga0123355_102519974 208
79 3300010049 Ga0123356_10138068 Ga0123356_101380681 208
80 3300010049 Ga0123356_10218159 Ga0123356_102181591 208
81 3300010049 Ga0123356_10225506 Ga0123356_102255063 208
82 3300010049 Ga0123356_10226397 Ga0123356_102263972 208
83 3300010049 Ga0123356_10300909 Ga0123356_103009092 208
84 3300010049 Ga0123356_10385590 Ga0123356_103855901 208
85 3300010049 Ga0123356_10498741 Ga0123356_104987413 208
86 3300010049 Ga0123356_10761306 Ga0123356_107613062 208
87 3300010049 Ga0123356_10820432 Ga0123356_108204322 208
88 3300010167 Ga0123353_10557488 Ga0123353_105574881 208
89 3300010167 Ga0123353_10656095 Ga0123353_106560952 208
90 3300010167 Ga0123353_10818168 Ga0123353_108181682 208
91 3300010882 Ga0123354_10087877 Ga0123354_100878772 208
92 3300010882 Ga0123354_10208836 Ga0123354_102088363 208
93 3300010882 Ga0123354_10316925 Ga0123354_103169251 208
94 3300010882 Ga0123354_10331681 Ga0123354_103316812 208
95 3300010882 Ga0123354_10331811 Ga0123354_103318111 208
96 3300000036 IMNBGM34_c002267 IMNBGM34_0022673 209
97 3300010167 Ga0123353_11859073 Ga0123353_118590731 216
98 3300042598 Ga0466701_020806 Ga0466701_020806_394_1056 220
99 3300042600 Ga0466700_195185 Ga0466700_195185_1792_2454 220
100 3300042600 Ga0466700_370663 Ga0466700_370663_149_811 220
101 3300042615 Ga0466711_013513 Ga0466711_013513_782_1444 220
102 3300002462 JGI24702J35022_10118649 JGI24702J35022_101186492 221
103 3300002462 JGI24702J35022_10123447 JGI24702J35022_101234472 221
104 3300042594 Ga0466694_400267 Ga0466694_400267_716_1384 222
105 3300042595 Ga0466695_064557 Ga0466695_064557_623_1297 224
106 3300010049 Ga0123356_10355563 Ga0123356_103555633 225
107 3300042619 Ga0466726_291274 Ga0466726_291274_286_975 229
108 3300042655 Ga0466727_028862 Ga0466727_028862_5440_6129 229
109 3300042598 Ga0466701_081393 Ga0466701_081393_763_1461 232

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13358 DDE_3 DDE superfamily endonuclease 18 169 0.95

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.79 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.