Protein Family IF02865
Metagenome
Isolate
109
Members
38
Samples
108
Scaffolds
207.66
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10226397|Ga0123356_102263972
- Length
- 208 aa
- Sequence
- MEDILDVYTQKYDRNRILICMDEAPRQLIEETRIPIAMKPGKIARYDTEYKRNGTCEVFMFTAPLKGWRRAEITEKRTRIDWAVQIKKLLTVDFPEGEKIILVMDNLNTHTKGSLYQAFPPEEAKCYCDRIEIHYTPKHGSWLNMAEIEINVLVNHGLSKRVPTIEQMKKEVAAWNKSRNKTASKINWRFTTDDARIKLKRLYPLFD*
Sample Types
Isolate
0.9%
Metagenome
99.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
73.7%
Kalotermitidae
13.2%
Passalidae
5.3%
Termopsidae
5.3%
Unclassified
2.6%
Taxonomy
Archaea
5
Bacteria
88
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 5 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 31 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 32 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 33 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 34 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_116332 | 3300042611 | Bacteria | 1748 |
| 2 | Ga0123356_10225506 | 3300010049 | Bacteria | 1934 |
| 3 | Ga0123354_10316925 | 3300010882 | Bacteria | 1446 |
| 4 | Ga0466657_134947 | 3300042582 | Bacteria | 1329 |
| 5 | Ga0466657_315145 | 3300042582 | Bacteria | 1109 |
| 6 | Ga0466693_090119 | 3300042592 | Unclassified | 1304 |
| 7 | Ga0466695_036267 | 3300042595 | Unclassified | 3812 |
| 8 | Ga0466717_114582 | 3300042604 | Bacteria | 1436 |
| 9 | Ga0466721_103405 | 3300042608 | Bacteria | 1529 |
| 10 | Ga0466721_230725 | 3300042608 | Bacteria | 1696 |
| 11 | Ga0466731_073846 | 3300042622 | Bacteria | 1503 |
| 12 | Ga0466731_108202 | 3300042622 | Bacteria | 3041 |
| 13 | Ga0466734_048603 | 3300042623 | Unclassified | 1585 |
| 14 | Ga0466710_370074 | 3300042613 | Bacteria | 1513 |
| 15 | Ga0123356_10138068 | 3300010049 | Unclassified | 2400 |
| 16 | Ga0123353_10656095 | 3300010167 | Bacteria | 1484 |
| 17 | Ga0466656_167375 | 3300042550 | Bacteria | 1748 |
| 18 | Ga0466656_195047 | 3300042550 | Bacteria | 1516 |
| 19 | Ga0466657_305055 | 3300042582 | Bacteria | 1828 |
| 20 | Ga0466693_252218 | 3300042592 | Bacteria | 1619 |
| 21 | Ga0466693_338200 | 3300042592 | Unclassified | 1398 |
| 22 | Ga0466694_033841 | 3300042594 | Bacteria | 1404 |
| 23 | Ga0466694_400267 | 3300042594 | Bacteria | 2344 |
| 24 | Ga0466719_427802 | 3300042606 | Bacteria | 1382 |
| 25 | Ga0466721_127957 | 3300042608 | Bacteria | 1413 |
| 26 | Ga0466721_404494 | 3300042608 | Bacteria | 1131 |
| 27 | 2227495209 | 2225789004 | Bacteria | 3954 |
| 28 | JGI24702J35022_10118649 | 3300002462 | Bacteria | 1460 |
| 29 | JGI24705J35276_12171519 | 3300002504 | Unclassified | 1296 |
| 30 | Ga0466697_244122 | 3300042611 | Unclassified | 1477 |
| 31 | Ga0466710_252875 | 3300042613 | Archaea | 1198 |
| 32 | Ga0123356_10498741 | 3300010049 | Bacteria | 1373 |
| 33 | Ga0123354_10208836 | 3300010882 | Bacteria | 2118 |
| 34 | Ga0123354_10292910 | 3300010882 | Bacteria | 1556 |
| 35 | Ga0466694_065166 | 3300042594 | Bacteria | 1531 |
| 36 | Ga0466701_020806 | 3300042598 | Bacteria | 1782 |
| 37 | Ga0466700_195185 | 3300042600 | Bacteria | 2991 |
| 38 | Ga0466734_055046 | 3300042623 | Bacteria | 1657 |
| 39 | Ga0466734_089947 | 3300042623 | Bacteria | 1313 |
| 40 | Ga0466703_183262 | 3300042636 | Bacteria | 1379 |
| 41 | Ga0466704_227153 | 3300042643 | Bacteria | 1164 |
| 42 | Ga0466709_100833 | 3300042648 | Bacteria | 15068 |
| 43 | Ga0466710_188364 | 3300042613 | Bacteria | 2660 |
| 44 | Ga0466710_359409 | 3300042613 | Unclassified | 1359 |
| 45 | Ga0466712_314350 | 3300042614 | Bacteria | 1353 |
| 46 | Ga0466726_291274 | 3300042619 | Bacteria | 1412 |
| 47 | Ga0123356_10218159 | 3300010049 | Archaea | 1962 |
| 48 | Ga0123356_10226397 | 3300010049 | Bacteria | 1931 |
| 49 | Ga0123356_10355563 | 3300010049 | Bacteria | 1590 |
| 50 | Ga0123354_10087877 | 3300010882 | Bacteria | 4329 |
| 51 | Ga0123354_10331681 | 3300010882 | Bacteria | 1386 |
| 52 | Ga0466700_210767 | 3300042600 | Bacteria | 1326 |
| 53 | Ga0466721_256264 | 3300042608 | Bacteria | 1654 |
| 54 | Ga0466721_270061 | 3300042608 | Bacteria | 1442 |
| 55 | JGI24695J34938_10077544 | 3300002450 | Bacteria | 1378 |
| 56 | JGI24702J35022_10459752 | 3300002462 | Unclassified | 776 |
| 57 | Ga0123355_10251997 | 3300009826 | Bacteria | 2484 |
| 58 | Ga0123353_10818168 | 3300010167 | Bacteria | 1283 |
| 59 | Ga0123353_12543723 | 3300010167 | Bacteria | 608 |
| 60 | Ga0466656_338192 | 3300042550 | Bacteria | 1718 |
| 61 | Ga0466694_167016 | 3300042594 | Archaea | 1166 |
| 62 | Ga0466699_057445 | 3300042597 | Bacteria | 1382 |
| 63 | Ga0466721_122487 | 3300042608 | Unclassified | 1205 |
| 64 | IMNBGM34_c002267 | 3300000036 | Bacteria | 2864 |
| 65 | Ga0466734_086889 | 3300042623 | Bacteria | 1766 |
| 66 | Ga0466724_35810 | 3300042649 | Bacteria | 1329 |
| 67 | Ga0466718_122209 | 3300042617 | Bacteria | 2333 |
| 68 | Ga0466718_132344 | 3300042617 | Bacteria | 1230 |
| 69 | Ga0123357_10185494 | 3300009784 | Bacteria | 2414 |
| 70 | Ga0123356_10300909 | 3300010049 | Bacteria | 1709 |
| 71 | Ga0123356_10385590 | 3300010049 | Bacteria | 1535 |
| 72 | Ga0123353_10557488 | 3300010167 | Bacteria | 1651 |
| 73 | Ga0123354_10331811 | 3300010882 | Bacteria | 1385 |
| 74 | Ga0466656_160144 | 3300042550 | Bacteria | 1370 |
| 75 | Ga0466657_399943 | 3300042582 | Bacteria | 1409 |
| 76 | Ga0466699_096649 | 3300042597 | Bacteria | 1253 |
| 77 | Ga0466701_081393 | 3300042598 | Bacteria | 1648 |
| 78 | Ga0466700_370663 | 3300042600 | Bacteria | 1058 |
| 79 | Ga0466717_104498 | 3300042604 | Bacteria | 1515 |
| 80 | Ga0466721_034502 | 3300042608 | Bacteria | 1666 |
| 81 | Ga0466698_474074 | 3300042610 | Bacteria | 3361 |
| 82 | Ga0466697_017782 | 3300042611 | Bacteria | 1858 |
| 83 | Ga0466697_032881 | 3300042611 | Bacteria | 1374 |
| 84 | Ga0466731_094714 | 3300042622 | Bacteria | 1150 |
| 85 | Ga0466734_088598 | 3300042623 | Unclassified | 1607 |
| 86 | Ga0466734_117175 | 3300042623 | Bacteria | 1264 |
| 87 | Ga0466734_165815 | 3300042623 | Bacteria | 1433 |
| 88 | Ga0466725_183102 | 3300042654 | Unclassified | 1266 |
| 89 | Ga0466727_028862 | 3300042655 | Bacteria | 6798 |
| 90 | Ga0466711_219030 | 3300042615 | Bacteria | 1209 |
| 91 | Ga0123356_10761306 | 3300010049 | Unclassified | 1139 |
| 92 | Ga0466656_321340 | 3300042550 | Archaea | 1469 |
| 93 | Ga0466657_383494 | 3300042582 | Bacteria | 3412 |
| 94 | Ga0466693_041916 | 3300042592 | Bacteria | 1059 |
| 95 | Ga0466695_064557 | 3300042595 | Bacteria | 1408 |
| 96 | Ga0466717_080733 | 3300042604 | Unclassified | 1376 |
| 97 | Ga0466717_294400 | 3300042604 | Bacteria | 1426 |
| 98 | Ga0466697_179398 | 3300042611 | Bacteria | 1618 |
| 99 | Ga0466711_013513 | 3300042615 | Bacteria | 1602 |
| 100 | Ga0466718_007064 | 3300042617 | Bacteria | 3048 |
| 101 | Ga0123356_10820432 | 3300010049 | Bacteria | 1101 |
| 102 | Ga0123353_11859073 | 3300010167 | Bacteria | 745 |
| 103 | Ga0466694_165265 | 3300042594 | Unclassified | 1865 |
| 104 | Ga0466694_239613 | 3300042594 | Bacteria | 1388 |
| 105 | Ga0466699_238780 | 3300042597 | Bacteria | 1373 |
| 106 | JGI24702J35022_10123447 | 3300002462 | Bacteria | 1432 |
| 107 | JGI24705J35276_12173622 | 3300002504 | Unclassified | 1311 |
| 108 | JGI24696J40584_12914360 | 3300002834 | Archaea | 1284 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042617 | Ga0466718_007064 | Ga0466718_007064_711_1271 | 186 |
| 2 | 3300002462 | JGI24702J35022_10459752 | JGI24702J35022_104597521 | 187 |
| 3 | 3300042592 | Ga0466693_041916 | Ga0466693_041916_83_646 | 187 |
| 4 | 3300042595 | Ga0466695_036267 | Ga0466695_036267_82_645 | 187 |
| 5 | 3300010167 | Ga0123353_12543723 | Ga0123353_125437231 | 188 |
| 6 | 3300042654 | Ga0466725_183102 | Ga0466725_183102_518_1141 | 188 |
| 7 | 3300042611 | Ga0466697_116332 | Ga0466697_116332_667_1290 | 195 |
| 8 | 3300010882 | Ga0123354_10292910 | Ga0123354_102929103 | 196 |
| 9 | 3300042610 | Ga0466698_474074 | Ga0466698_474074_1409_2011 | 200 |
| 10 | 3300042608 | Ga0466721_034502 | Ga0466721_034502_735_1340 | 201 |
| 11 | 3300042550 | Ga0466656_338192 | Ga0466656_338192_108_725 | 205 |
| 12 | 3300042608 | Ga0466721_122487 | Ga0466721_122487_245_862 | 205 |
| 13 | 3300042622 | Ga0466731_094714 | Ga0466731_094714_21_638 | 205 |
| 14 | 2225789004 | 2227495209 | 2227971810 | 207 |
| 15 | 3300042550 | Ga0466656_160144 | Ga0466656_160144_105_728 | 207 |
| 16 | 3300042550 | Ga0466656_167375 | Ga0466656_167375_303_926 | 207 |
| 17 | 3300042550 | Ga0466656_195047 | Ga0466656_195047_758_1381 | 207 |
| 18 | 3300042550 | Ga0466656_321340 | Ga0466656_321340_64_687 | 207 |
| 19 | 3300042582 | Ga0466657_134947 | Ga0466657_134947_621_1244 | 207 |
| 20 | 3300042582 | Ga0466657_305055 | Ga0466657_305055_1069_1692 | 207 |
| 21 | 3300042582 | Ga0466657_315145 | Ga0466657_315145_351_974 | 207 |
| 22 | 3300042582 | Ga0466657_383494 | Ga0466657_383494_740_1363 | 207 |
| 23 | 3300042582 | Ga0466657_399943 | Ga0466657_399943_149_772 | 207 |
| 24 | 3300042592 | Ga0466693_090119 | Ga0466693_090119_584_1207 | 207 |
| 25 | 3300042592 | Ga0466693_252218 | Ga0466693_252218_851_1474 | 207 |
| 26 | 3300042592 | Ga0466693_338200 | Ga0466693_338200_198_821 | 207 |
| 27 | 3300042594 | Ga0466694_033841 | Ga0466694_033841_108_731 | 207 |
| 28 | 3300042594 | Ga0466694_065166 | Ga0466694_065166_621_1244 | 207 |
| 29 | 3300042594 | Ga0466694_165265 | Ga0466694_165265_1180_1803 | 207 |
| 30 | 3300042594 | Ga0466694_167016 | Ga0466694_167016_207_830 | 207 |
| 31 | 3300042594 | Ga0466694_239613 | Ga0466694_239613_647_1270 | 207 |
| 32 | 3300042597 | Ga0466699_057445 | Ga0466699_057445_495_1118 | 207 |
| 33 | 3300042597 | Ga0466699_096649 | Ga0466699_096649_536_1159 | 207 |
| 34 | 3300042597 | Ga0466699_238780 | Ga0466699_238780_64_687 | 207 |
| 35 | 3300042600 | Ga0466700_210767 | Ga0466700_210767_13_636 | 207 |
| 36 | 3300042604 | Ga0466717_080733 | Ga0466717_080733_617_1240 | 207 |
| 37 | 3300042604 | Ga0466717_104498 | Ga0466717_104498_161_784 | 207 |
| 38 | 3300042604 | Ga0466717_114582 | Ga0466717_114582_99_722 | 207 |
| 39 | 3300042604 | Ga0466717_294400 | Ga0466717_294400_104_727 | 207 |
| 40 | 3300042606 | Ga0466719_427802 | Ga0466719_427802_109_732 | 207 |
| 41 | 3300042608 | Ga0466721_103405 | Ga0466721_103405_116_739 | 207 |
| 42 | 3300042608 | Ga0466721_127957 | Ga0466721_127957_94_717 | 207 |
| 43 | 3300042608 | Ga0466721_230725 | Ga0466721_230725_343_966 | 207 |
| 44 | 3300042608 | Ga0466721_256264 | Ga0466721_256264_587_1210 | 207 |
| 45 | 3300042608 | Ga0466721_270061 | Ga0466721_270061_755_1378 | 207 |
| 46 | 3300042608 | Ga0466721_404494 | Ga0466721_404494_384_1007 | 207 |
| 47 | 3300042611 | Ga0466697_017782 | Ga0466697_017782_299_922 | 207 |
| 48 | 3300042611 | Ga0466697_032881 | Ga0466697_032881_707_1330 | 207 |
| 49 | 3300042611 | Ga0466697_179398 | Ga0466697_179398_846_1469 | 207 |
| 50 | 3300042611 | Ga0466697_244122 | Ga0466697_244122_197_820 | 207 |
| 51 | 3300042613 | Ga0466710_188364 | Ga0466710_188364_1115_1738 | 207 |
| 52 | 3300042613 | Ga0466710_252875 | Ga0466710_252875_142_765 | 207 |
| 53 | 3300042613 | Ga0466710_359409 | Ga0466710_359409_661_1284 | 207 |
| 54 | 3300042613 | Ga0466710_370074 | Ga0466710_370074_206_829 | 207 |
| 55 | 3300042614 | Ga0466712_314350 | Ga0466712_314350_213_836 | 207 |
| 56 | 3300042615 | Ga0466711_219030 | Ga0466711_219030_576_1199 | 207 |
| 57 | 3300042617 | Ga0466718_122209 | Ga0466718_122209_1605_2228 | 207 |
| 58 | 3300042617 | Ga0466718_132344 | Ga0466718_132344_214_837 | 207 |
| 59 | 3300042622 | Ga0466731_073846 | Ga0466731_073846_154_777 | 207 |
| 60 | 3300042622 | Ga0466731_108202 | Ga0466731_108202_968_1591 | 207 |
| 61 | 3300042623 | Ga0466734_048603 | Ga0466734_048603_235_858 | 207 |
| 62 | 3300042623 | Ga0466734_055046 | Ga0466734_055046_76_699 | 207 |
| 63 | 3300042623 | Ga0466734_086889 | Ga0466734_086889_1000_1623 | 207 |
| 64 | 3300042623 | Ga0466734_088598 | Ga0466734_088598_762_1385 | 207 |
| 65 | 3300042623 | Ga0466734_089947 | Ga0466734_089947_602_1225 | 207 |
| 66 | 3300042623 | Ga0466734_117175 | Ga0466734_117175_620_1243 | 207 |
| 67 | 3300042623 | Ga0466734_165815 | Ga0466734_165815_648_1271 | 207 |
| 68 | 3300042636 | Ga0466703_183262 | Ga0466703_183262_31_654 | 207 |
| 69 | 3300042643 | Ga0466704_227153 | Ga0466704_227153_344_967 | 207 |
| 70 | 3300042648 | Ga0466709_100833 | Ga0466709_100833_1517_2140 | 207 |
| 71 | 3300042649 | Ga0466724_35810 | Ga0466724_35810_605_1228 | 207 |
| 72 | iso_pr_bacteria | 2820740053 | 2820741839 | 207 |
| 73 | 3300002450 | JGI24695J34938_10077544 | JGI24695J34938_100775441 | 208 |
| 74 | 3300002504 | JGI24705J35276_12171519 | JGI24705J35276_121715191 | 208 |
| 75 | 3300002504 | JGI24705J35276_12173622 | JGI24705J35276_121736221 | 208 |
| 76 | 3300002834 | JGI24696J40584_12914360 | JGI24696J40584_129143601 | 208 |
| 77 | 3300009784 | Ga0123357_10185494 | Ga0123357_101854942 | 208 |
| 78 | 3300009826 | Ga0123355_10251997 | Ga0123355_102519974 | 208 |
| 79 | 3300010049 | Ga0123356_10138068 | Ga0123356_101380681 | 208 |
| 80 | 3300010049 | Ga0123356_10218159 | Ga0123356_102181591 | 208 |
| 81 | 3300010049 | Ga0123356_10225506 | Ga0123356_102255063 | 208 |
| 82 | 3300010049 | Ga0123356_10226397 | Ga0123356_102263972 | 208 |
| 83 | 3300010049 | Ga0123356_10300909 | Ga0123356_103009092 | 208 |
| 84 | 3300010049 | Ga0123356_10385590 | Ga0123356_103855901 | 208 |
| 85 | 3300010049 | Ga0123356_10498741 | Ga0123356_104987413 | 208 |
| 86 | 3300010049 | Ga0123356_10761306 | Ga0123356_107613062 | 208 |
| 87 | 3300010049 | Ga0123356_10820432 | Ga0123356_108204322 | 208 |
| 88 | 3300010167 | Ga0123353_10557488 | Ga0123353_105574881 | 208 |
| 89 | 3300010167 | Ga0123353_10656095 | Ga0123353_106560952 | 208 |
| 90 | 3300010167 | Ga0123353_10818168 | Ga0123353_108181682 | 208 |
| 91 | 3300010882 | Ga0123354_10087877 | Ga0123354_100878772 | 208 |
| 92 | 3300010882 | Ga0123354_10208836 | Ga0123354_102088363 | 208 |
| 93 | 3300010882 | Ga0123354_10316925 | Ga0123354_103169251 | 208 |
| 94 | 3300010882 | Ga0123354_10331681 | Ga0123354_103316812 | 208 |
| 95 | 3300010882 | Ga0123354_10331811 | Ga0123354_103318111 | 208 |
| 96 | 3300000036 | IMNBGM34_c002267 | IMNBGM34_0022673 | 209 |
| 97 | 3300010167 | Ga0123353_11859073 | Ga0123353_118590731 | 216 |
| 98 | 3300042598 | Ga0466701_020806 | Ga0466701_020806_394_1056 | 220 |
| 99 | 3300042600 | Ga0466700_195185 | Ga0466700_195185_1792_2454 | 220 |
| 100 | 3300042600 | Ga0466700_370663 | Ga0466700_370663_149_811 | 220 |
| 101 | 3300042615 | Ga0466711_013513 | Ga0466711_013513_782_1444 | 220 |
| 102 | 3300002462 | JGI24702J35022_10118649 | JGI24702J35022_101186492 | 221 |
| 103 | 3300002462 | JGI24702J35022_10123447 | JGI24702J35022_101234472 | 221 |
| 104 | 3300042594 | Ga0466694_400267 | Ga0466694_400267_716_1384 | 222 |
| 105 | 3300042595 | Ga0466695_064557 | Ga0466695_064557_623_1297 | 224 |
| 106 | 3300010049 | Ga0123356_10355563 | Ga0123356_103555633 | 225 |
| 107 | 3300042619 | Ga0466726_291274 | Ga0466726_291274_286_975 | 229 |
| 108 | 3300042655 | Ga0466727_028862 | Ga0466727_028862_5440_6129 | 229 |
| 109 | 3300042598 | Ga0466701_081393 | Ga0466701_081393_763_1461 | 232 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13358 | DDE_3 | DDE superfamily endonuclease | 18 | 169 | 0.95 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.77 | 0.79 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.