Protein Family IF02841
Metagenome
Isolate
257
Members
58
Samples
245
Scaffolds
344.49
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10167954|Ga0123356_101679542
- Length
- 365 aa
- Sequence
- MFLFSSGVESFSTTRLRPDPAAGSGSYPVLRRFFTVFLLLLVFGGTAGAESLAMPLVTGSVDFIREQRPVFPEAYFTDFLHEQNAGDAARPYWAASEFESASAAFPLQESILLNNDILAFYGSPRSKNMGILGRHSKEELNEKLSALAAEYKTAGGRNIAKAFYIIFGTVWPGGEIGIIQESLLREYIDFAQENGILIFIDHQIGRYTPADSLKRMLPWLKYPNVHLALDPEWRTTKPMQEIGSVTADEINQVQRVMEEYMIENQIPGERLLVIHQFNYRMISSREKVESNLSKVRLVHCADGFGAPSMKRTSYTFNAQADNIPVKGFKLFYNFGIPGAGYDDPLLSPKEVFELNPRPYIVMYQ*
Sample Types
Isolate
4.7%
Metagenome
95.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.5%
Unclassified
25.0%
Kalotermitidae
25.0%
Rhinotermitidae
7.1%
Termopsidae
5.4%
Taxonomy
Archaea
3
Bacteria
242
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 2 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 3 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 4 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 28 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 35 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 44 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 45 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 46 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 47 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 48 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 53 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 54 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 55 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 56 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 57 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 58 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_362244 | 3300042612 | Bacteria | 5241 |
| 2 | JGI24695J34938_10001186 | 3300002450 | Bacteria | 23154 |
| 3 | JGI24695J34938_10003111 | 3300002450 | Bacteria | 11845 |
| 4 | JGI24695J34938_10004514 | 3300002450 | Unclassified | 9094 |
| 5 | Ga0466715_109874 | 3300042616 | Bacteria | 11767 |
| 6 | Ga0466715_616184 | 3300042616 | Bacteria | 1492 |
| 7 | Ga0466726_200027 | 3300042619 | Bacteria | 10984 |
| 8 | Ga0466726_201552 | 3300042619 | Bacteria | 3953 |
| 9 | Ga0466726_255624 | 3300042619 | Bacteria | 4161 |
| 10 | Ga0466735_166421 | 3300042624 | Bacteria | 1166 |
| 11 | Ga0466703_356682 | 3300042636 | Bacteria | 16653 |
| 12 | Ga0466704_260639 | 3300042643 | Bacteria | 5257 |
| 13 | Ga0466704_621694 | 3300042643 | Bacteria | 1702 |
| 14 | Ga0466709_071792 | 3300042648 | Bacteria | 9996 |
| 15 | Ga0466709_140045 | 3300042648 | Bacteria | 12847 |
| 16 | Ga0466708_303528 | 3300042652 | Bacteria | 5587 |
| 17 | Ga0466727_200064 | 3300042655 | Bacteria | 11575 |
| 18 | Ga0466707_308267 | 3300042601 | Bacteria | 1270 |
| 19 | Ga0466713_099192 | 3300042602 | Bacteria | 31166 |
| 20 | Ga0466722_192619 | 3300042609 | Bacteria | 53930 |
| 21 | Ga0466690_267934 | 3300042590 | Bacteria | 11044 |
| 22 | Ga0466692_044169 | 3300042591 | Bacteria | 5626 |
| 23 | Ga0466692_070457 | 3300042591 | Bacteria | 14299 |
| 24 | Ga0466691_159543 | 3300042593 | Bacteria | 16586 |
| 25 | Ga0466699_004843 | 3300042597 | Bacteria | 2234 |
| 26 | Ga0466699_029090 | 3300042597 | Bacteria | 4298 |
| 27 | Ga0466699_036223 | 3300042597 | Bacteria | 2877 |
| 28 | Ga0466699_233514 | 3300042597 | Bacteria | 1478 |
| 29 | Ga0466699_334356 | 3300042597 | Bacteria | 1672 |
| 30 | Ga0466732_049629 | 3300042656 | Bacteria | 22386 |
| 31 | JGI24698J34947_10003253 | 3300002449 | Bacteria | 8795 |
| 32 | JGI24695J34938_10004365 | 3300002450 | Bacteria | 9313 |
| 33 | Ga0466711_331291 | 3300042615 | Bacteria | 4643 |
| 34 | Ga0466715_070904 | 3300042616 | Bacteria | 9793 |
| 35 | Ga0466715_209840 | 3300042616 | Bacteria | 13413 |
| 36 | Ga0466715_430104 | 3300042616 | Bacteria | 12828 |
| 37 | Ga0466718_110012 | 3300042617 | Bacteria | 4847 |
| 38 | Ga0466723_071657 | 3300042618 | Bacteria | 3598 |
| 39 | Ga0466728_123040 | 3300042620 | Bacteria | 25921 |
| 40 | Ga0123356_10172718 | 3300010049 | Bacteria | 2174 |
| 41 | Ga0466735_231480 | 3300042624 | Bacteria | 35469 |
| 42 | Ga0466730_052075 | 3300042625 | Bacteria | 1323 |
| 43 | Ga0466703_121736 | 3300042636 | Bacteria | 2923 |
| 44 | Ga0466704_040140 | 3300042643 | Bacteria | 12885 |
| 45 | Ga0466704_108975 | 3300042643 | Bacteria | 4322 |
| 46 | Ga0466704_203185 | 3300042643 | Bacteria | 3391 |
| 47 | Ga0466709_186697 | 3300042648 | Bacteria | 4817 |
| 48 | Ga0466709_286489 | 3300042648 | Bacteria | 5348 |
| 49 | Ga0466708_038601 | 3300042652 | Bacteria | 4197 |
| 50 | Ga0466727_079199 | 3300042655 | Bacteria | 5628 |
| 51 | Ga0466707_036267 | 3300042601 | Bacteria | 2810 |
| 52 | Ga0466717_239982 | 3300042604 | Bacteria | 2552 |
| 53 | Ga0466720_065584 | 3300042607 | Bacteria | 5467 |
| 54 | Ga0466722_220612 | 3300042609 | Bacteria | 2096 |
| 55 | Ga0466690_002784 | 3300042590 | Bacteria | 2814 |
| 56 | Ga0466692_071358 | 3300042591 | Bacteria | 7027 |
| 57 | Ga0466692_082297 | 3300042591 | Bacteria | 1834 |
| 58 | Ga0466696_335197 | 3300042596 | Bacteria | 35443 |
| 59 | Ga0466699_187150 | 3300042597 | Bacteria | 9818 |
| 60 | Ga0466699_328108 | 3300042597 | Bacteria | 3662 |
| 61 | Ga0466705_082328 | 3300042612 | Bacteria | 3829 |
| 62 | Ga0466705_257983 | 3300042612 | Bacteria | 5806 |
| 63 | Ga0466733_107932 | 3300042659 | Bacteria | 2504 |
| 64 | JGI24695J34938_10000098 | 3300002450 | Bacteria | 76790 |
| 65 | JGI24695J34938_10002823 | 3300002450 | Bacteria | 12690 |
| 66 | JGI24695J34938_10011205 | 3300002450 | Bacteria | 4848 |
| 67 | JGI24695J34938_10107582 | 3300002450 | Unclassified | 1137 |
| 68 | Ga0466712_161250 | 3300042614 | Bacteria | 1805 |
| 69 | Ga0466712_235964 | 3300042614 | Bacteria | 3157 |
| 70 | Ga0466711_109505 | 3300042615 | Bacteria | 28818 |
| 71 | Ga0466715_529316 | 3300042616 | Bacteria | 13287 |
| 72 | Ga0466715_645557 | 3300042616 | Bacteria | 2170 |
| 73 | Ga0466718_016028 | 3300042617 | Bacteria | 3442 |
| 74 | Ga0123356_10002801 | 3300010049 | Bacteria | 18479 |
| 75 | Ga0466704_106224 | 3300042643 | Bacteria | 12218 |
| 76 | Ga0466704_118982 | 3300042643 | Bacteria | 9196 |
| 77 | Ga0466704_150062 | 3300042643 | Bacteria | 40395 |
| 78 | Ga0466709_059925 | 3300042648 | Bacteria | 2538 |
| 79 | Ga0466708_228934 | 3300042652 | Bacteria | 7316 |
| 80 | Ga0466727_146517 | 3300042655 | Bacteria | 1192 |
| 81 | Ga0466719_337834 | 3300042606 | Bacteria | 4790 |
| 82 | Ga0466720_167202 | 3300042607 | Bacteria | 9605 |
| 83 | Ga0466722_023768 | 3300042609 | Bacteria | 1650 |
| 84 | Ga0466722_233014 | 3300042609 | Bacteria | 7403 |
| 85 | Ga0466690_009384 | 3300042590 | Bacteria | 2931 |
| 86 | Ga0466692_191981 | 3300042591 | Bacteria | 6311 |
| 87 | Ga0466691_043492 | 3300042593 | Bacteria | 6062 |
| 88 | Ga0466694_042400 | 3300042594 | Bacteria | 28566 |
| 89 | Ga0466694_071595 | 3300042594 | Unclassified | 2103 |
| 90 | Ga0466694_129232 | 3300042594 | Bacteria | 10191 |
| 91 | Ga0466699_121031 | 3300042597 | Bacteria | 18413 |
| 92 | Ga0466699_442400 | 3300042597 | Bacteria | 41005 |
| 93 | Ga0466705_147421 | 3300042612 | Bacteria | 10791 |
| 94 | AustNasuHG_c1007506 | 3300000089 | Bacteria | 3878 |
| 95 | JGI24698J34947_10000559 | 3300002449 | Bacteria | 17667 |
| 96 | JGI24695J34938_10004149 | 3300002450 | Bacteria | 9642 |
| 97 | JGI24695J34938_10036502 | 3300002450 | Bacteria | 2240 |
| 98 | Ga0072941_1038996 | 3300005201 | Bacteria | 10450 |
| 99 | Ga0466712_207225 | 3300042614 | Bacteria | 28717 |
| 100 | Ga0466711_144814 | 3300042615 | Bacteria | 5504 |
| 101 | Ga0466711_429354 | 3300042615 | Bacteria | 2925 |
| 102 | Ga0466715_020324 | 3300042616 | Bacteria | 13812 |
| 103 | Ga0466715_357284 | 3300042616 | Bacteria | 7906 |
| 104 | Ga0466715_370762 | 3300042616 | Bacteria | 3387 |
| 105 | Ga0466728_333459 | 3300042620 | Bacteria | 2836 |
| 106 | Ga0466729_191956 | 3300042621 | Bacteria | 1598 |
| 107 | Ga0123356_10091884 | 3300010049 | Bacteria | 2894 |
| 108 | Ga0123356_10167954 | 3300010049 | Bacteria | 2201 |
| 109 | Ga0123353_10219659 | 3300010167 | Bacteria | 2973 |
| 110 | Ga0123354_10033503 | 3300010882 | Bacteria | 8040 |
| 111 | Ga0466704_043614 | 3300042643 | Bacteria | 3328 |
| 112 | Ga0466708_024889 | 3300042652 | Bacteria | 7670 |
| 113 | Ga0466707_250102 | 3300042601 | Bacteria | 4207 |
| 114 | Ga0466716_062275 | 3300042605 | Bacteria | 7302 |
| 115 | Ga0466719_047566 | 3300042606 | Bacteria | 14696 |
| 116 | Ga0466719_150148 | 3300042606 | Bacteria | 1384 |
| 117 | Ga0466719_384052 | 3300042606 | Bacteria | 21348 |
| 118 | Ga0466720_156019 | 3300042607 | Bacteria | 55009 |
| 119 | Ga0466694_134960 | 3300042594 | Bacteria | 10008 |
| 120 | Ga0466694_353510 | 3300042594 | Bacteria | 1312 |
| 121 | Ga0466699_094340 | 3300042597 | Bacteria | 3642 |
| 122 | Ga0466699_273936 | 3300042597 | Unclassified | 1675 |
| 123 | AustNasuHG_c1001470 | 3300000089 | Bacteria | 8461 |
| 124 | AustNasuHG_c1011136 | 3300000089 | Bacteria | 3120 |
| 125 | JGI24698J34947_10009545 | 3300002449 | Bacteria | 5323 |
| 126 | JGI24695J34938_10000407 | 3300002450 | Bacteria | 41969 |
| 127 | JGI24695J34938_10001161 | 3300002450 | Bacteria | 23440 |
| 128 | Ga0074263_104335 | 3300005485 | Bacteria | 1323 |
| 129 | Ga0466711_355744 | 3300042615 | Bacteria | 24186 |
| 130 | Ga0466715_116608 | 3300042616 | Bacteria | 2665 |
| 131 | Ga0466718_008974 | 3300042617 | Bacteria | 11809 |
| 132 | Ga0466718_155615 | 3300042617 | Bacteria | 3778 |
| 133 | Ga0466723_145307 | 3300042618 | Bacteria | 8361 |
| 134 | Ga0466723_349290 | 3300042618 | Bacteria | 1861 |
| 135 | Ga0123356_10279026 | 3300010049 | Unclassified | 1765 |
| 136 | Ga0123353_10686116 | 3300010167 | Bacteria | 1441 |
| 137 | Ga0466709_016938 | 3300042648 | Bacteria | 3647 |
| 138 | Ga0466709_401069 | 3300042648 | Bacteria | 2653 |
| 139 | Ga0466720_039512 | 3300042607 | Bacteria | 7703 |
| 140 | Ga0466720_158896 | 3300042607 | Bacteria | 14512 |
| 141 | Ga0466690_302323 | 3300042590 | Bacteria | 16268 |
| 142 | Ga0466692_114184 | 3300042591 | Archaea | 1661 |
| 143 | Ga0466692_175157 | 3300042591 | Bacteria | 2513 |
| 144 | Ga0466699_039424 | 3300042597 | Bacteria | 11527 |
| 145 | Ga0466699_162291 | 3300042597 | Bacteria | 25591 |
| 146 | Ga0466705_335186 | 3300042612 | Bacteria | 1167 |
| 147 | Ga0466705_356528 | 3300042612 | Bacteria | 4559 |
| 148 | Ga0466733_025788 | 3300042659 | Bacteria | 29898 |
| 149 | Ga0466733_074499 | 3300042659 | Bacteria | 3677 |
| 150 | JGI24698J34947_10002402 | 3300002449 | Bacteria | 10081 |
| 151 | JGI24698J34947_10051713 | 3300002449 | Bacteria | 2065 |
| 152 | JGI24695J34938_10000475 | 3300002450 | Bacteria | 38958 |
| 153 | JGI24695J34938_10037764 | 3300002450 | Unclassified | 2192 |
| 154 | JGI24702J35022_10023560 | 3300002462 | Bacteria | 3328 |
| 155 | Ga0072940_1006407 | 3300005200 | Bacteria | 9864 |
| 156 | Ga0072941_1011961 | 3300005201 | Bacteria | 4452 |
| 157 | Ga0466712_099974 | 3300042614 | Bacteria | 14085 |
| 158 | Ga0466715_506292 | 3300042616 | Bacteria | 9425 |
| 159 | Ga0466723_214031 | 3300042618 | Bacteria | 5701 |
| 160 | Ga0123353_10042769 | 3300010167 | Bacteria | 7170 |
| 161 | Ga0466704_164892 | 3300042643 | Bacteria | 2211 |
| 162 | Ga0466704_264198 | 3300042643 | Bacteria | 36997 |
| 163 | Ga0466709_330937 | 3300042648 | Bacteria | 14936 |
| 164 | Ga0466708_032826 | 3300042652 | Bacteria | 4286 |
| 165 | Ga0466708_076862 | 3300042652 | Bacteria | 1308 |
| 166 | Ga0466707_386444 | 3300042601 | Bacteria | 4106 |
| 167 | Ga0466720_012187 | 3300042607 | Bacteria | 4913 |
| 168 | Ga0466720_072412 | 3300042607 | Bacteria | 9749 |
| 169 | Ga0466720_105936 | 3300042607 | Bacteria | 4617 |
| 170 | Ga0466720_140496 | 3300042607 | Bacteria | 17361 |
| 171 | Ga0466722_064168 | 3300042609 | Bacteria | 4432 |
| 172 | Ga0466698_185606 | 3300042610 | Bacteria | 1950 |
| 173 | Ga0466691_173095 | 3300042593 | Bacteria | 12873 |
| 174 | Ga0466695_073621 | 3300042595 | Bacteria | 3513 |
| 175 | Ga0466696_134342 | 3300042596 | Bacteria | 4584 |
| 176 | Ga0466699_153757 | 3300042597 | Unclassified | 2102 |
| 177 | Ga0466699_169008 | 3300042597 | Bacteria | 25209 |
| 178 | Ga0466705_020864 | 3300042612 | Bacteria | 24538 |
| 179 | Ga0466705_066203 | 3300042612 | Bacteria | 15169 |
| 180 | Ga0466705_124031 | 3300042612 | Bacteria | 12371 |
| 181 | Ga0466732_178103 | 3300042656 | Bacteria | 2640 |
| 182 | Ga0466733_163179 | 3300042659 | Bacteria | 1908 |
| 183 | AustNasuHG_c1010769 | 3300000089 | Bacteria | 3179 |
| 184 | AustNasuHG_c1037287 | 3300000089 | Unclassified | 1245 |
| 185 | JGI24698J34947_10005531 | 3300002449 | Unclassified | 6933 |
| 186 | Ga0466705_435024 | 3300042612 | Unclassified | 1779 |
| 187 | Ga0466712_191808 | 3300042614 | Bacteria | 5253 |
| 188 | Ga0466711_265426 | 3300042615 | Archaea | 6242 |
| 189 | Ga0466715_014248 | 3300042616 | Bacteria | 6534 |
| 190 | Ga0466715_603694 | 3300042616 | Bacteria | 2712 |
| 191 | Ga0466718_167097 | 3300042617 | Bacteria | 1698 |
| 192 | Ga0466723_241064 | 3300042618 | Bacteria | 3798 |
| 193 | Ga0466726_418559 | 3300042619 | Bacteria | 3585 |
| 194 | Ga0466728_073447 | 3300042620 | Bacteria | 2006 |
| 195 | Ga0123354_10241439 | 3300010882 | Bacteria | 1857 |
| 196 | Ga0466709_150278 | 3300042648 | Bacteria | 2550 |
| 197 | Ga0466709_269924 | 3300042648 | Unclassified | 1939 |
| 198 | Ga0466708_030166 | 3300042652 | Bacteria | 1990 |
| 199 | Ga0466727_123316 | 3300042655 | Bacteria | 7805 |
| 200 | Ga0466727_265162 | 3300042655 | Bacteria | 1932 |
| 201 | Ga0466727_340709 | 3300042655 | Bacteria | 1378 |
| 202 | Ga0466716_484387 | 3300042605 | Bacteria | 1717 |
| 203 | Ga0466719_125599 | 3300042606 | Bacteria | 2366 |
| 204 | Ga0466719_297647 | 3300042606 | Bacteria | 41658 |
| 205 | Ga0466720_107517 | 3300042607 | Bacteria | 53647 |
| 206 | Ga0456237_0000547 | 3300041968 | Bacteria | 5730 |
| 207 | Ga0466693_195495 | 3300042592 | Bacteria | 30612 |
| 208 | Ga0466694_315307 | 3300042594 | Bacteria | 1825 |
| 209 | Ga0466696_263983 | 3300042596 | Bacteria | 7435 |
| 210 | Ga0466699_002049 | 3300042597 | Unclassified | 4303 |
| 211 | Ga0466732_391645 | 3300042656 | Bacteria | 3036 |
| 212 | Ga0466733_022507 | 3300042659 | Bacteria | 4634 |
| 213 | AustNasuHG_c1021799 | 3300000089 | Bacteria | 2068 |
| 214 | JGI24695J34938_10000003 | 3300002450 | Bacteria | 167365 |
| 215 | JGI24695J34938_10005341 | 3300002450 | Bacteria | 8035 |
| 216 | Ga0466705_506241 | 3300042612 | Bacteria | 9637 |
| 217 | Ga0466711_322087 | 3300042615 | Bacteria | 11104 |
| 218 | Ga0466715_575778 | 3300042616 | Bacteria | 2587 |
| 219 | Ga0466718_017040 | 3300042617 | Bacteria | 2893 |
| 220 | Ga0466718_028222 | 3300042617 | Bacteria | 2713 |
| 221 | Ga0466718_074315 | 3300042617 | Bacteria | 22338 |
| 222 | Ga0466718_102600 | 3300042617 | Bacteria | 17725 |
| 223 | Ga0466726_175531 | 3300042619 | Bacteria | 1200 |
| 224 | Ga0466728_246716 | 3300042620 | Archaea | 2250 |
| 225 | Ga0123353_10179683 | 3300010167 | Bacteria | 3351 |
| 226 | Ga0123353_10228397 | 3300010167 | Bacteria | 2904 |
| 227 | Ga0123353_10688972 | 3300010167 | Bacteria | 1437 |
| 228 | Ga0466703_349861 | 3300042636 | Bacteria | 12134 |
| 229 | Ga0466709_343163 | 3300042648 | Bacteria | 3815 |
| 230 | Ga0466727_293446 | 3300042655 | Bacteria | 1509 |
| 231 | Ga0466707_328793 | 3300042601 | Bacteria | 1831 |
| 232 | Ga0466716_117293 | 3300042605 | Bacteria | 3445 |
| 233 | Ga0466719_139969 | 3300042606 | Bacteria | 6100 |
| 234 | Ga0466720_109967 | 3300042607 | Bacteria | 6594 |
| 235 | Ga0466720_133652 | 3300042607 | Bacteria | 5139 |
| 236 | Ga0264413_116411 | 3300024493 | Bacteria | 10004 |
| 237 | Ga0466690_283371 | 3300042590 | Bacteria | 2045 |
| 238 | Ga0466691_020872 | 3300042593 | Bacteria | 4645 |
| 239 | Ga0466691_054723 | 3300042593 | Bacteria | 13333 |
| 240 | Ga0466691_096265 | 3300042593 | Bacteria | 2000 |
| 241 | Ga0466691_223143 | 3300042593 | Bacteria | 4582 |
| 242 | Ga0466694_029610 | 3300042594 | Bacteria | 31558 |
| 243 | Ga0466694_185422 | 3300042594 | Bacteria | 2625 |
| 244 | Ga0466694_204975 | 3300042594 | Bacteria | 2919 |
| 245 | Ga0466699_281092 | 3300042597 | Bacteria | 3686 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.