Protein Family IF02836

Metagenome Isolate
131 Members
48 Samples
116 Scaffolds
184.07 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10160277|Ga0123356_101602774
Length
208 aa
Sequence
MYIIITASPNKDGLTDACGKAALEGILSAGGNAEVYDISDTKLEPCRICGNGWGTCRDSSKCVINDNLAELQDKIRDSEGVILVVPVYFGQPSERMKYFLDRFRRCEAFNKDGSAAAGKQVDLIAAAGGSGNGTATCLAEMEQWCRHVGATTRERIGVTRFNRTTIIPVITDATTRLVKGDYFKRPKSDHITKEPCSLYPTYRALCV*

📊 Sample Types

Isolate 11.4%
Metagenome 88.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 45.8%
Unclassified 33.3%
Kalotermitidae 12.5%
Termopsidae 4.2%
Rhinotermitidae 2.1%
Hodotermitidae 2.1%

🌳 Taxonomy

Archaea 4
Bacteria 92
Eukaryota 0
Viruses 0
Unclassified 35

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
2 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
3 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
4 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
5 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
6 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
8 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
14 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
15 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
16 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
20 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
21 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
22 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
25 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
26 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
27 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
28 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
29 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
30 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
31 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
32 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
33 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
34 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
35 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
36 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
37 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
38 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
39 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
40 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
41 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
42 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
43 2820403592 Unclassified Firmicutes Lab288P4bin93 Isolate Unclassified
44 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
45 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
46 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_273406 3300042612 Bacteria 7421
2 Ga0123356_10124201 3300010049 Unclassified 2517
3 Ga0123353_10000117 3300010167 Bacteria 93955
4 Ga0123353_10207814 3300010167 Unclassified 3073
5 Ga0123353_10307961 3300010167 Bacteria 2413
6 Ga0123353_10486693 3300010167 Bacteria 1803
7 Ga0123353_10706654 3300010167 Bacteria 1413
8 Ga0123353_10799553 3300010167 Unclassified 1302
9 Ga0123354_10191109 3300010882 Archaea 2292
10 Ga0466718_088222 3300042617 Unclassified 1018
11 Ga0466704_407403 3300042643 Unclassified 1635
12 Ga0466724_56726 3300042649 Bacteria 1748
13 Ga0466717_189931 3300042604 Unclassified 1336
14 Ga0466722_123247 3300042609 Bacteria 8131
15 Ga0466693_251385 3300042592 Bacteria 2651
16 Ga0123357_10005077 3300009784 Archaea 15671
17 Ga0123355_10028766 3300009826 Unclassified 8989
18 Ga0123356_10704345 3300010049 Bacteria 1179
19 Ga0123356_11809523 3300010049 Unclassified 759
20 Ga0123353_10274053 3300010167 Bacteria 2597
21 Ga0123353_10445452 3300010167 Unclassified 1909
22 Ga0123353_10805416 3300010167 Unclassified 1296
23 Ga0123353_10813623 3300010167 Archaea 1288
24 Ga0123353_11335577 3300010167 Bacteria 928
25 Ga0123354_10042899 3300010882 Unclassified 6964
26 Ga0123354_10155070 3300010882 Unclassified 2752
27 Ga0466718_118677 3300042617 Unclassified 1396
28 Ga0466728_479026 3300042620 Bacteria 1701
29 Ga0466706_192747 3300042599 Bacteria 2890
30 Ga0466717_176734 3300042604 Bacteria 25127
31 Ga0466694_003467 3300042594 Unclassified 3698
32 Ga0466695_188608 3300042595 Unclassified 2307
33 Ga0123355_10068066 3300009826 Bacteria 5729
34 Ga0123355_10075853 3300009826 Bacteria 5380
35 Ga0123353_10828638 3300010167 Unclassified 1272
36 JGI24702J35022_10011634 3300002462 Bacteria 4904
37 JGI24705J35276_12225028 3300002504 Bacteria 2674
38 JGI24705J35276_12236221 3300002504 Bacteria 7674
39 Ga0123357_10001776 3300009784 Bacteria 23337
40 Ga0466705_494760 3300042612 Unclassified 1866
41 Ga0466735_056632 3300042624 Bacteria 2319
42 Ga0466703_179129 3300042636 Bacteria 4160
43 Ga0466706_004078 3300042599 Bacteria 8123
44 Ga0466706_093800 3300042599 Bacteria 3637
45 Ga0466706_235752 3300042599 Bacteria 3421
46 Ga0466700_148223 3300042600 Bacteria 3957
47 Ga0466714_061321 3300042603 Bacteria 1427
48 Ga0466714_137641 3300042603 Unclassified 1059
49 Ga0466721_303657 3300042608 Bacteria 1094
50 Ga0466722_015150 3300042609 Bacteria 1804
51 Ga0466697_263711 3300042611 Bacteria 3085
52 Ga0123355_10272896 3300009826 Unclassified 2347
53 Ga0123355_10286497 3300009826 Bacteria 2266
54 Ga0123355_10320139 3300009826 Bacteria 2091
55 Ga0123356_10040285 3300010049 Bacteria 4352
56 Ga0123353_10000585 3300010167 Bacteria 44501
57 Ga0123353_10128711 3300010167 Bacteria 4066
58 Ga0123353_10923908 3300010167 Unclassified 1184
59 Ga0123353_11236507 3300010167 Bacteria 976
60 Ga0123353_11477456 3300010167 Unclassified 867
61 Ga0123354_10356920 3300010882 Unclassified 1294
62 JGI24702J35022_10016487 3300002462 Unclassified 4049
63 Ga0068305_10003905 3300005083 Bacteria 42618
64 Ga0466704_425472 3300042643 Bacteria 1490
65 Ga0466701_075124 3300042598 Bacteria 3277
66 Ga0466706_118318 3300042599 Bacteria 4359
67 Ga0466714_162117 3300042603 Bacteria 1562
68 Ga0466717_250521 3300042604 Bacteria 1766
69 Ga0123353_10007060 3300010167 Bacteria 15109
70 Ga0123353_10479024 3300010167 Bacteria 1821
71 Ga0123353_11041499 3300010167 Bacteria 1094
72 Ga0123353_11255799 3300010167 Unclassified 966
73 Ga0466702_317464 3300042635 Bacteria 1303
74 Ga0466704_065113 3300042643 Bacteria 2215
75 Ga0466704_136250 3300042643 Unclassified 3583
76 Ga0466706_236825 3300042599 Bacteria 6060
77 Ga0466722_235052 3300042609 Bacteria 1407
78 Ga0123353_10051899 3300010167 Bacteria 6546
79 Ga0123353_10149416 3300010167 Bacteria 3731
80 Ga0123353_10597587 3300010167 Unclassified 1578
81 Ga0123353_12046511 3300010167 Bacteria 699
82 Ga0466703_333625 3300042636 Bacteria 3758
83 Ga0466703_367189 3300042636 Bacteria 4005
84 Ga0466706_157046 3300042599 Bacteria 2483
85 Ga0466694_045514 3300042594 Bacteria 2472
86 Ga0466696_503844 3300042596 Bacteria 2750
87 Ga0466705_053892 3300042612 Bacteria 2681
88 Ga0123357_10343076 3300009784 Archaea 1441
89 Ga0123356_10005273 3300010049 Bacteria 13195
90 Ga0123356_10879922 3300010049 Bacteria 1067
91 Ga0123353_10288346 3300010167 Bacteria 2515
92 Ga0123353_10440374 3300010167 Bacteria 1923
93 Ga0123353_10757759 3300010167 Bacteria 1350
94 Ga0123354_10136060 3300010882 Unclassified 3072
95 JGI24702J35022_10019005 3300002462 Unclassified 3742
96 Ga0466702_145411 3300042635 Unclassified 1123
97 Ga0466727_196006 3300042655 Unclassified 1386
98 Ga0466706_102943 3300042599 Bacteria 8030
99 Ga0466706_208213 3300042599 Bacteria 4256
100 Ga0466706_284965 3300042599 Bacteria 14596
101 Ga0466714_035180 3300042603 Unclassified 1585
102 Ga0466721_293765 3300042608 Bacteria 2566
103 Ga0466698_437340 3300042610 Bacteria 2872
104 Ga0123355_11010681 3300009826 Unclassified 881
105 Ga0123356_10160277 3300010049 Bacteria 2246
106 Ga0123356_10210501 3300010049 Bacteria 1992
107 Ga0123356_10407730 3300010049 Bacteria 1498
108 Ga0123353_10514685 3300010167 Bacteria 1739
109 Ga0123353_10572978 3300010167 Bacteria 1622
110 Ga0123353_10611948 3300010167 Bacteria 1554
111 Ga0123353_11412418 3300010167 Unclassified 894
112 JGI24695J34938_10005700 3300002450 Bacteria 7689
113 JGI24702J35022_10000526 3300002462 Bacteria 23203
114 Ga0466698_340833 3300042610 Unclassified 1062
115 Ga0415639_006181 3300038395 Bacteria 4293
116 Ga0466691_145888 3300042593 Unclassified 3328

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03358 FMN_red NADPH-dependent FMN reductase 3 154 0.89
PF02525 Flavodoxin_2 Flavodoxin-like fold 3 158 0.8

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03358 GO:0016491 oxidoreductase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.