Protein Family IF02828

Metagenome Metatranscriptome Isolate
171 Members
89 Samples
117 Scaffolds
116.52 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10144135|Ga0123356_101441353
Length
126 aa
Sequence
MPRVKGGPVTRQRRKKILKLAKGYFGSKHLLYKTAHEQVMHSWKYAYTGRKQLKRNMRKLWIARINAAARLNDISYSQLVHGLALSNVAINRKMLSEIAIHDADGFSTICKQAKAALKKDAGKQQ*

📊 Sample Types

Isolate 31.6%
Metagenome 67.2%
MAG 0.0%
Metatranscriptome 1.2%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 32.9%
Termitidae 25.9%
Drosophilidae 21.2%
Tenebrionidae 5.9%
Kalotermitidae 4.7%
Apidae 3.5%
Rhinotermitidae 3.5%
Elmidae 1.2%
Termopsidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 152
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2857832487 Snodgrassella alvi HK9x Isolate Apidae
2 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
3 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
4 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
5 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
6 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
7 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
8 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
9 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
10 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
15 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
16 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
17 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
18 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
19 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
20 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
21 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
22 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
23 2868464004 Snodgrassella alvi Pens2-2-5 Isolate Apidae
24 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
25 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
26 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
27 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
28 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
29 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
30 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
34 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
35 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
36 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
37 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
38 3300021244 Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA Metatranscriptome Termitidae
39 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
40 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
41 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
42 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
43 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
44 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
45 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
46 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
47 2820094617 Unclassified Proteobacteria Lab288P3bin216 Isolate Unclassified
48 2820572885 Unclassified Firmicutes Emb289P3bin161 Isolate Unclassified
49 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
50 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
51 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
52 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
53 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
54 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
55 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
56 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
57 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
58 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
59 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
60 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
61 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
62 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
63 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
64 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
65 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
66 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
67 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
68 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
69 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
70 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
71 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
72 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
73 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
74 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
75 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
76 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
77 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
78 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
79 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
80 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
81 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
82 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
83 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
84 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
85 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
86 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
87 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
88 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
89 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0255809_1007268 3300022820 Bacteria 2004
2 Ga0466693_137397 3300042592 Bacteria 5012
3 Ga0123355_10000007 3300009826 Bacteria 193006
4 Ga0123355_10015490 3300009826 Bacteria 11984
5 Ga0123355_10420198 3300009826 Bacteria 1709
6 Ga0123355_10868449 3300009826 Bacteria 988
7 Ga0123355_11153019 3300009826 Bacteria 798
8 Ga0123355_11545711 3300009826 Bacteria 644
9 Ga0123355_11946818 3300009826 Bacteria 547
10 Ga0123356_10466035 3300010049 Bacteria 1414
11 Ga0123353_10109750 3300010167 Bacteria 4445
12 JGI24703J35330_11743290 3300002501 Unclassified 3870
13 Ga0466735_169210 3300042624 Bacteria 1060
14 Ga0466703_086607 3300042636 Bacteria 64365
15 Ga0123355_10000529 3300009826 Bacteria 51176
16 Ga0123355_10060361 3300009826 Bacteria 6123
17 Ga0123355_10654672 3300009826 Bacteria 1224
18 Ga0123355_10664469 3300009826 Unclassified 1211
19 Ga0123355_10702214 3300009826 Bacteria 1161
20 Ga0123355_10770264 3300009826 Unclassified 1082
21 Ga0123355_10922196 3300009826 Bacteria 944
22 Ga0123356_10789021 3300010049 Bacteria 1121
23 Ga0123353_10005270 3300010167 Bacteria 16910
24 Ga0123353_10286798 3300010167 Bacteria 2524
25 Ga0123353_11341856 3300010167 Unclassified 925
26 Ga0466723_097643 3300042618 Bacteria 16816
27 Ga0466722_237551 3300042609 Bacteria 19887
28 Ga0068305_10032695 3300005083 Bacteria 547
29 Ga0466725_090434 3300042654 Bacteria 1451
30 Ga0223686_1048231 3300021244 Bacteria 853
31 Ga0466693_423481 3300042592 Unclassified 1200
32 Ga0466699_363859 3300042597 Bacteria 1077
33 Ga0123355_10000073 3300009826 Bacteria 107394
34 Ga0123355_10001136 3300009826 Bacteria 36890
35 Ga0123355_10015783 3300009826 Bacteria 11879
36 Ga0123355_10040896 3300009826 Bacteria 7547
37 Ga0123355_10051278 3300009826 Unclassified 6697
38 Ga0123355_10215561 3300009826 Bacteria 2772
39 Ga0123356_10101374 3300010049 Unclassified 2762
40 Ga0123356_12339203 3300010049 Bacteria 668
41 Ga0123353_11893096 3300010167 Bacteria 736
42 Ga0466700_184501 3300042600 Bacteria 2581
43 Ga0466700_233026 3300042600 Bacteria 1801
44 JGI24695J34938_10320815 3300002450 Unclassified 674
45 Ga0466725_059408 3300042654 Bacteria 2399
46 Ga0466693_162034 3300042592 Bacteria 9294
47 Ga0466693_276773 3300042592 Bacteria 4677
48 Ga0123355_10003216 3300009826 Bacteria 23341
49 Ga0123355_10004372 3300009826 Unclassified 20555
50 Ga0123355_10125781 3300009826 Bacteria 3962
51 Ga0123355_10152769 3300009826 Bacteria 3501
52 Ga0123356_10027655 3300010049 Bacteria 5313
53 Ga0123356_10215729 3300010049 Bacteria 1972
54 Ga0123354_10038553 3300010882 Bacteria 7416
55 Ga0466714_118778 3300042603 Bacteria 2032
56 Ga0466721_171629 3300042608 Unclassified 1023
57 Ga0466702_269655 3300042635 Bacteria 1484
58 Ga0466705_226055 3300042612 Bacteria 32392
59 Ga0415639_102886 3300038395 Bacteria 4943
60 Ga0456237_0000286 3300041968 Bacteria 7445
61 Ga0466693_212244 3300042592 Bacteria 1312
62 Ga0123357_10339593 3300009784 Bacteria 1454
63 Ga0123355_10001878 3300009826 Bacteria 29479
64 Ga0123355_10004823 3300009826 Bacteria 19633
65 Ga0123355_10064369 3300009826 Bacteria 5910
66 Ga0123355_10066537 3300009826 Bacteria 5800
67 Ga0123355_10072455 3300009826 Bacteria 5525
68 Ga0123355_10155585 3300009826 Unclassified 3460
69 Ga0123355_10481725 3300009826 Bacteria 1543
70 Ga0123356_10066561 3300010049 Unclassified 3373
71 Ga0123356_12373863 3300010049 Unclassified 663
72 Ga0123353_10005577 3300010167 Bacteria 16553
73 Ga0466728_133030 3300042620 Bacteria 4664
74 Ga0466714_027186 3300042603 Bacteria 1722
75 JGI24703J35330_11748611 3300002501 Bacteria 22015
76 Ga0072941_1006283 3300005201 Bacteria 68986
77 Ga0466735_023325 3300042624 Bacteria 1239
78 Ga0562376_2780 3300056857 Bacteria 19627
79 Ga0562374_0255 3300057007 Bacteria 105455
80 Ga0123355_10008084 3300009826 Bacteria 15868
81 Ga0123355_10037618 3300009826 Bacteria 7869
82 Ga0123355_10055177 3300009826 Bacteria 6434
83 Ga0123355_10306285 3300009826 Bacteria 2159
84 Ga0123355_10557056 3300009826 Bacteria 1383
85 Ga0123355_10742729 3300009826 Bacteria 1112
86 Ga0123355_11589695 3300009826 Unclassified 631
87 Ga0123356_13036038 3300010049 Bacteria 586
88 JGI24695J34938_10069041 3300002450 Unclassified 1483
89 Ga0123355_10035325 3300009826 Bacteria 8124
90 Ga0123355_10259083 3300009826 Bacteria 2435
91 Ga0123355_10386633 3300009826 Bacteria 1818
92 Ga0123355_10666472 3300009826 Bacteria 1208
93 Ga0123355_10676106 3300009826 Bacteria 1195
94 Ga0466718_062579 3300042617 Bacteria 1143
95 Ga0466717_204189 3300042604 Bacteria 21668
96 Ga0466722_251828 3300042609 Bacteria 3271
97 JGI24703J35330_11747624 3300002501 Unclassified 7470
98 JGI24705J35276_12234563 3300002504 Bacteria 5632
99 Ga0562379_0021 3300056790 Bacteria 978093
100 Ga0562377_0136 3300056842 Bacteria 216882
101 Ga0415639_178505 3300038395 Bacteria 1016
102 Ga0466693_292544 3300042592 Bacteria 1717
103 Ga0123355_10000029 3300009826 Bacteria 143843
104 Ga0123355_10040200 3300009826 Bacteria 7613
105 Ga0123355_10073328 3300009826 Bacteria 5487
106 Ga0123355_10117569 3300009826 Unclassified 4133
107 Ga0123355_10246815 3300009826 Bacteria 2520
108 Ga0123355_10403296 3300009826 Unclassified 1762
109 Ga0123355_10547888 3300009826 Bacteria 1400
110 Ga0123356_10144135 3300010049 Bacteria 2354
111 Ga0123353_10528808 3300010167 Bacteria 1708
112 Ga0466698_216860 3300042610 Bacteria 2125
113 JGI24703J35330_11733996 3300002501 Unclassified 2881
114 JGI24700J35501_10930739 3300002508 Bacteria 21292
115 Ga0068305_10159557 3300005083 Bacteria 2152
116 Ga0466729_280882 3300042621 Bacteria 1118
117 Ga0466735_084582 3300042624 Bacteria 1817

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00453 Ribosomal_L20 Ribosomal protein L20 3 108 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.