Protein Family IF02824

Metagenome Isolate
133 Members
68 Samples
113 Scaffolds
263.05 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10137289|Ga0123356_101372892
Length
265 aa
Sequence
MSGDFYKTSNDIDTRLDLTKLRPYGDTMNDAKVQLSFTLPVPDDEKGIEAAKQLAKKMGLDPTVAHHEALDTNFSFYVVYGTVSHSVNYDKINVAADQDETMSMDEINTYIKENIGRKIVVVGASTGMDAHTVGIDAIINMKGLAGHYGLERYEMIEAHNLGSQVPNEEFVKKAIELRADVLLVSQTVTQKDIHIQNLTELVEILEAEGLRHKIALICGGSRISRELATELGYDAGFGSQKYAEDVADFFVKEIVKRNLGGIKR*

📊 Sample Types

Isolate 15.0%
Metagenome 85.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.3%
Unclassified 26.9%
Kalotermitidae 19.4%
Blattidae 4.5%
Termopsidae 4.5%
Passalidae 3.0%
Rhinotermitidae 3.0%
Hodotermitidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 127
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
2 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
5 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
6 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
7 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
8 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
9 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
10 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
11 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
12 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
13 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
14 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
15 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
16 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
17 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
18 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
19 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
20 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
21 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
22 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
23 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
24 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
25 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
26 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
27 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
28 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
29 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
30 2820219087 Unclassified Ignavibacteria Th196P3bin14 Isolate Unclassified
31 2590828840 Clostridium sp. 2 Isolate Termitidae
32 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
33 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
34 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
35 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
36 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
37 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
38 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
39 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
40 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
41 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
42 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
43 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
44 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
46 3004677695 Bacteroides sp. 214 Isolate Blattidae
47 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
48 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
49 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
50 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
51 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
52 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
53 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
54 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
55 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
56 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
57 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
58 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
59 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
60 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
61 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
62 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
63 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
64 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
65 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
66 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
67 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
68 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_152092 3300042659 Bacteria 12447
2 Ga0123356_10137289 3300010049 Bacteria 2406
3 Ga0123353_10000901 3300010167 Bacteria 36273
4 Ga0123353_10248447 3300010167 Bacteria 2758
5 Ga0123353_10288258 3300010167 Bacteria 2515
6 Ga0466714_049478 3300042603 Bacteria 2458
7 Ga0466698_053166 3300042610 Bacteria 1061
8 Ga0466657_060443 3300042582 Bacteria 5829
9 Ga0466696_017314 3300042596 Bacteria 29765
10 Ga0466699_394451 3300042597 Bacteria 1201
11 IMNBL1DRAFT_c0009080 3300000062 Bacteria 4974
12 JGI24702J35022_10012237 3300002462 Bacteria 4773
13 JGI24702J35022_10027656 3300002462 Bacteria 3050
14 Ga0072941_1038322 3300005201 Bacteria 6477
15 Ga0466731_110573 3300042622 Bacteria 1291
16 Ga0466709_124130 3300042648 Bacteria 272718
17 Ga0466709_221860 3300042648 Bacteria 264751
18 Ga0466725_331143 3300042654 Bacteria 1756
19 Ga0466712_137772 3300042614 Bacteria 1780
20 Ga0466723_278942 3300042618 Bacteria 7050
21 Ga0123353_10742973 3300010167 Bacteria 1367
22 Ga0123353_10797221 3300010167 Bacteria 1305
23 Ga0466701_024426 3300042598 Bacteria 2238
24 Ga0466706_135044 3300042599 Bacteria 3185
25 Ga0466722_138182 3300042609 Bacteria 4429
26 JGI24695J34938_10005947 3300002450 Bacteria 7469
27 JGI24702J35022_10045131 3300002462 Bacteria 2348
28 JGI24696J40584_12929109 3300002834 Bacteria 1449
29 Ga0466705_076183 3300042612 Bacteria 28969
30 Ga0466735_089390 3300042624 Bacteria 1285
31 Ga0466711_242882 3300042615 Bacteria 8718
32 Ga0466711_352888 3300042615 Bacteria 18887
33 Ga0466723_164565 3300042618 Bacteria 21152
34 Ga0466726_334046 3300042619 Bacteria 5951
35 Ga0466732_200412 3300042656 Bacteria 2387
36 Ga0123353_10021906 3300010167 Bacteria 9607
37 Ga0466714_030487 3300042603 Bacteria 1409
38 Ga0466717_303013 3300042604 Bacteria 1841
39 Ga0466694_003591 3300042594 Bacteria 2570
40 JGI24702J35022_10174326 3300002462 Bacteria 1218
41 Ga0466697_244820 3300042611 Bacteria 3575
42 Ga0466729_267849 3300042621 Unclassified 2717
43 Ga0466731_408688 3300042622 Bacteria 5111
44 Ga0466708_414229 3300042652 Bacteria 11089
45 Ga0466705_425951 3300042612 Bacteria 15257
46 Ga0123354_10254045 3300010882 Bacteria 1773
47 Ga0466716_338172 3300042605 Bacteria 9324
48 Ga0466720_063918 3300042607 Bacteria 1763
49 Ga0466722_251244 3300042609 Bacteria 2812
50 Ga0466691_001985 3300042593 Bacteria 8464
51 Ga0466694_308321 3300042594 Bacteria 9564
52 Ga0466695_361834 3300042595 Bacteria 1081
53 Ga0466701_004455 3300042598 Bacteria 2734
54 2227530175 2225789004 Bacteria 16438
55 JGI24702J35022_10056131 3300002462 Bacteria 2101
56 JGI24705J35276_12192021 3300002504 Bacteria 1482
57 Ga0466704_273038 3300042643 Bacteria 5025
58 Ga0466708_327175 3300042652 Bacteria 21277
59 Ga0466710_060028 3300042613 Bacteria 3996
60 Ga0466715_255880 3300042616 Bacteria 2742
61 Ga0123356_10191002 3300010049 Unclassified 2079
62 Ga0123356_10945828 3300010049 Bacteria 1033
63 Ga0123353_10000005 3300010167 Bacteria 308504
64 Ga0123353_10141813 3300010167 Bacteria 3848
65 Ga0466706_034884 3300042599 Bacteria 1385
66 Ga0466706_136725 3300042599 Bacteria 9042
67 Ga0466690_211303 3300042590 Bacteria 10167
68 Ga0466696_215575 3300042596 Bacteria 13266
69 IMNBL1DRAFT_c0034354 3300000062 Bacteria 1805
70 JGI24702J35022_10024465 3300002462 Unclassified 3263
71 Ga0466703_315251 3300042636 Bacteria 11800
72 Ga0466727_170296 3300042655 Bacteria 17471
73 Ga0123356_10011635 3300010049 Bacteria 8572
74 Ga0123356_10356158 3300010049 Bacteria 1589
75 Ga0123353_10001838 3300010167 Bacteria 26117
76 Ga0123353_10022756 3300010167 Unclassified 9463
77 Ga0123354_10246871 3300010882 Bacteria 1820
78 Ga0466707_236424 3300042601 Bacteria 2003
79 Ga0466707_381722 3300042601 Bacteria 29352
80 Ga0466713_064041 3300042602 Bacteria 54434
81 Ga0466719_211673 3300042606 Bacteria 1152
82 Ga0466696_072183 3300042596 Bacteria 6258
83 Ga0466696_176785 3300042596 Bacteria 19925
84 Ga0466696_182525 3300042596 Bacteria 3875
85 Ga0466701_000978 3300042598 Bacteria 49977
86 JGI24702J35022_10112040 3300002462 Bacteria 1500
87 Ga0466729_304674 3300042621 Bacteria 1475
88 Ga0466709_062901 3300042648 Bacteria 45932
89 Ga0466709_160542 3300042648 Bacteria 33247
90 Ga0466724_17255 3300042649 Bacteria 1822
91 Ga0466725_393472 3300042654 Bacteria 1081
92 Ga0466710_081852 3300042613 Bacteria 4622
93 Ga0466712_044476 3300042614 Bacteria 1358
94 Ga0123356_10053653 3300010049 Bacteria 3753
95 Ga0466701_060621 3300042598 Bacteria 1332
96 Ga0466717_279430 3300042604 Bacteria 2823
97 Ga0466691_159487 3300042593 Bacteria 59353
98 Ga0466696_123838 3300042596 Bacteria 7857
99 Ga0068305_10031913 3300005083 Bacteria 23399
100 Ga0466710_155547 3300042613 Bacteria 2891
101 Ga0466723_101296 3300042618 Bacteria 56220
102 Ga0466726_144066 3300042619 Bacteria 2375
103 Ga0123356_10492112 3300010049 Bacteria 1381
104 Ga0123353_10037734 3300010167 Bacteria 7582
105 Ga0123353_10388732 3300010167 Unclassified 2083
106 Ga0466706_218164 3300042599 Bacteria 5926
107 Ga0466717_139672 3300042604 Bacteria 3324
108 Ga0466696_095583 3300042596 Bacteria 6362
109 Ga0466696_214078 3300042596 Bacteria 40025
110 JGI24702J35022_10067252 3300002462 Unclassified 1924
111 Ga0466705_140987 3300042612 Bacteria 39987
112 Ga0466731_224230 3300042622 Bacteria 50413
113 Ga0466703_044278 3300042636 Bacteria 5862

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF16554 OAM_dimer Dimerisation domain of d-ornithine 4,5-aminomutase 21 95 0.97
PF02310 B12-binding B12 binding domain 120 243 0.93

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF16554 GO:0046983 protein dimerization activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.