Protein Family IF02812
Metagenome
Isolate
134
Members
44
Samples
121
Scaffolds
319.96
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10117262|Ga0123356_101172623
- Length
- 350 aa
- Sequence
- MMSEKLLEVRNLKKYFKTKAGMLHAVDDVSFHINRGETLGLVGESGCGKSTIGRVILRLIEATGGEVFFEGENILEYNKAKMGKMRENMQIVFQDPFASLNPRMSVFETIAEPLKINKKAGSGPELYRKVHSLMETVGLASRLENAYPHELDGGRRQRVGIARALALKPKFIVQDEPVSALDVSIQAQILNLMDNLQKEFGLTYLFISHDLSVIKHASDNVAVMYLGKMVEMSDYRSLFADPLHPYTKALLSAIPVPDPDHKKERIILEGDVPSPISPPPGCRFFNRCFARIDMCKDTTPELKPAGNGRFCACHLVNGPYPYPDEQKVIDQYRKNPVASLDWEAVKTSI*
Sample Types
Isolate
9.7%
Metagenome
90.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.1%
Unclassified
31.0%
Kalotermitidae
19.0%
Termopsidae
7.1%
Passalidae
4.8%
Taxonomy
Archaea
0
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 5 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 6 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 7 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 8 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 9 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 10 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 13 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 14 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 19 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 22 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 23 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 26 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 27 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 30 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 31 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 38 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 39 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 40 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466726_158060 | 3300042619 | Bacteria | 1753 |
| 2 | Ga0466726_219389 | 3300042619 | Bacteria | 12229 |
| 3 | Ga0466707_042142 | 3300042601 | Unclassified | 18832 |
| 4 | Ga0466707_330741 | 3300042601 | Bacteria | 21560 |
| 5 | Ga0466707_353006 | 3300042601 | Bacteria | 2230 |
| 6 | Ga0466713_062272 | 3300042602 | Bacteria | 36909 |
| 7 | Ga0415639_061286 | 3300038395 | Bacteria | 4569 |
| 8 | Ga0123355_10175691 | 3300009826 | Bacteria | 3190 |
| 9 | Ga0123356_10353744 | 3300010049 | Bacteria | 1593 |
| 10 | Ga0123356_10638219 | 3300010049 | Bacteria | 1232 |
| 11 | Ga0123353_10739278 | 3300010167 | Bacteria | 1372 |
| 12 | JGI24695J34938_10015409 | 3300002450 | Bacteria | 3924 |
| 13 | JGI24702J35022_10000321 | 3300002462 | Bacteria | 28517 |
| 14 | Ga0466709_231608 | 3300042648 | Bacteria | 2372 |
| 15 | Ga0466724_41336 | 3300042649 | Bacteria | 1737 |
| 16 | Ga0466711_126361 | 3300042615 | Bacteria | 7718 |
| 17 | Ga0466715_460288 | 3300042616 | Bacteria | 36963 |
| 18 | Ga0466723_032488 | 3300042618 | Unclassified | 8961 |
| 19 | Ga0466723_248411 | 3300042618 | Bacteria | 16699 |
| 20 | Ga0466726_073859 | 3300042619 | Bacteria | 9941 |
| 21 | Ga0264413_134355 | 3300024493 | Bacteria | 3005 |
| 22 | Ga0123355_10110634 | 3300009826 | Bacteria | 4293 |
| 23 | Ga0123356_10004217 | 3300010049 | Bacteria | 14867 |
| 24 | Ga0123353_10000021 | 3300010167 | Bacteria | 176788 |
| 25 | Ga0123354_10302991 | 3300010882 | Bacteria | 1508 |
| 26 | JGI24695J34938_10041443 | 3300002450 | Bacteria | 2067 |
| 27 | JGI24695J34938_10081821 | 3300002450 | Bacteria | 1333 |
| 28 | Ga0466705_010343 | 3300042612 | Bacteria | 12858 |
| 29 | Ga0466711_285268 | 3300042615 | Bacteria | 9618 |
| 30 | Ga0466707_181535 | 3300042601 | Bacteria | 18712 |
| 31 | Ga0466719_529613 | 3300042606 | Bacteria | 1812 |
| 32 | Ga0415639_002513 | 3300038395 | Bacteria | 8069 |
| 33 | Ga0415639_035881 | 3300038395 | Bacteria | 2879 |
| 34 | Ga0123355_10185820 | 3300009826 | Bacteria | 3073 |
| 35 | Ga0123356_10119201 | 3300010049 | Bacteria | 2563 |
| 36 | Ga0123353_10048222 | 3300010167 | Bacteria | 6780 |
| 37 | Ga0466708_423287 | 3300042652 | Bacteria | 2911 |
| 38 | Ga0466697_261085 | 3300042611 | Bacteria | 1186 |
| 39 | Ga0466705_236769 | 3300042612 | Bacteria | 2018 |
| 40 | Ga0466723_338262 | 3300042618 | Bacteria | 3417 |
| 41 | Ga0466707_041906 | 3300042601 | Unclassified | 1409 |
| 42 | Ga0466707_061437 | 3300042601 | Bacteria | 7385 |
| 43 | Ga0466707_218330 | 3300042601 | Bacteria | 1330 |
| 44 | Ga0466707_247194 | 3300042601 | Bacteria | 1284 |
| 45 | Ga0466719_311711 | 3300042606 | Bacteria | 1932 |
| 46 | Ga0466699_332664 | 3300042597 | Bacteria | 2110 |
| 47 | Ga0123355_10004444 | 3300009826 | Bacteria | 20393 |
| 48 | Ga0123355_10222654 | 3300009826 | Bacteria | 2710 |
| 49 | Ga0123355_10224312 | 3300009826 | Bacteria | 2696 |
| 50 | Ga0123355_10259215 | 3300009826 | Bacteria | 2434 |
| 51 | Ga0123356_10005273 | 3300010049 | Bacteria | 13195 |
| 52 | Ga0123353_10040763 | 3300010167 | Bacteria | 7329 |
| 53 | Ga0123353_10111373 | 3300010167 | Bacteria | 4409 |
| 54 | Ga0123353_10396339 | 3300010167 | Bacteria | 2057 |
| 55 | Ga0123353_10602648 | 3300010167 | Bacteria | 1569 |
| 56 | JGI24695J34938_10010471 | 3300002450 | Bacteria | 5070 |
| 57 | Ga0466725_004350 | 3300042654 | Bacteria | 7118 |
| 58 | Ga0466705_431940 | 3300042612 | Bacteria | 12327 |
| 59 | Ga0466707_189805 | 3300042601 | Bacteria | 2104 |
| 60 | Ga0466719_457446 | 3300042606 | Bacteria | 4855 |
| 61 | Ga0415639_031875 | 3300038395 | Unclassified | 6793 |
| 62 | Ga0123355_10004029 | 3300009826 | Bacteria | 21287 |
| 63 | Ga0123355_10181231 | 3300009826 | Bacteria | 3126 |
| 64 | Ga0123356_10002219 | 3300010049 | Bacteria | 20917 |
| 65 | Ga0123356_10113607 | 3300010049 | Unclassified | 2620 |
| 66 | JGI24702J35022_10059761 | 3300002462 | Bacteria | 2037 |
| 67 | Ga0466709_392285 | 3300042648 | Bacteria | 1262 |
| 68 | Ga0466725_007974 | 3300042654 | Bacteria | 2728 |
| 69 | Ga0466725_016059 | 3300042654 | Bacteria | 6624 |
| 70 | Ga0466705_026009 | 3300042612 | Bacteria | 1464 |
| 71 | Ga0466719_317446 | 3300042606 | Bacteria | 13811 |
| 72 | Ga0123355_10000647 | 3300009826 | Bacteria | 47181 |
| 73 | Ga0123355_10000903 | 3300009826 | Bacteria | 41123 |
| 74 | Ga0123355_10010550 | 3300009826 | Bacteria | 14178 |
| 75 | Ga0123356_10005093 | 3300010049 | Bacteria | 13469 |
| 76 | Ga0123356_10117262 | 3300010049 | Bacteria | 2583 |
| 77 | Ga0123356_10166476 | 3300010049 | Bacteria | 2209 |
| 78 | Ga0123353_10046778 | 3300010167 | Bacteria | 6879 |
| 79 | IMNBL1DRAFT_c0003461 | 3300000062 | Bacteria | 10133 |
| 80 | JGI24702J35022_10000713 | 3300002462 | Bacteria | 20399 |
| 81 | JGI24702J35022_10135693 | 3300002462 | Bacteria | 1369 |
| 82 | JGI24705J35276_12231759 | 3300002504 | Bacteria | 4054 |
| 83 | JGI24700J35501_10930869 | 3300002508 | Bacteria | 30582 |
| 84 | Ga0072941_1316839 | 3300005201 | Bacteria | 2663 |
| 85 | Ga0466725_352811 | 3300042654 | Bacteria | 3267 |
| 86 | Ga0466727_242754 | 3300042655 | Bacteria | 3349 |
| 87 | Ga0466713_033235 | 3300042602 | Bacteria | 2598 |
| 88 | Ga0415639_181560 | 3300038395 | Bacteria | 1875 |
| 89 | Ga0466693_045657 | 3300042592 | Bacteria | 3567 |
| 90 | Ga0466693_373826 | 3300042592 | Bacteria | 2865 |
| 91 | Ga0123355_10041317 | 3300009826 | Bacteria | 7508 |
| 92 | Ga0123355_10393067 | 3300009826 | Bacteria | 1796 |
| 93 | Ga0123355_10450784 | 3300009826 | Unclassified | 1621 |
| 94 | Ga0123356_10082155 | 3300010049 | Unclassified | 3050 |
| 95 | Ga0123353_10092185 | 3300010167 | Bacteria | 4880 |
| 96 | Ga0123353_10121241 | 3300010167 | Bacteria | 4205 |
| 97 | Ga0123353_10168669 | 3300010167 | Bacteria | 3477 |
| 98 | 2227135538 | 2225789004 | Bacteria | 1642 |
| 99 | JGI24695J34938_10050963 | 3300002450 | Bacteria | 1814 |
| 100 | JGI24705J35276_12188088 | 3300002504 | Bacteria | 1437 |
| 101 | Ga0466704_537809 | 3300042643 | Bacteria | 9577 |
| 102 | Ga0466724_59476 | 3300042649 | Bacteria | 3425 |
| 103 | Ga0466705_079951 | 3300042612 | Bacteria | 1593 |
| 104 | Ga0466705_525706 | 3300042612 | Bacteria | 3805 |
| 105 | Ga0466723_102746 | 3300042618 | Bacteria | 23052 |
| 106 | Ga0466726_128048 | 3300042619 | Bacteria | 13480 |
| 107 | Ga0466707_015036 | 3300042601 | Bacteria | 1978 |
| 108 | Ga0466707_051905 | 3300042601 | Bacteria | 19459 |
| 109 | Ga0466707_065326 | 3300042601 | Bacteria | 14421 |
| 110 | Ga0466707_209014 | 3300042601 | Bacteria | 2020 |
| 111 | Ga0466713_126310 | 3300042602 | Bacteria | 2964 |
| 112 | Ga0466717_137840 | 3300042604 | Bacteria | 4324 |
| 113 | Ga0123355_10004125 | 3300009826 | Bacteria | 21059 |
| 114 | Ga0123355_10226387 | 3300009826 | Bacteria | 2679 |
| 115 | Ga0123356_10050891 | 3300010049 | Unclassified | 3854 |
| 116 | Ga0123353_10238010 | 3300010167 | Bacteria | 2831 |
| 117 | Ga0123353_10280184 | 3300010167 | Bacteria | 2561 |
| 118 | Ga0123353_10515683 | 3300010167 | Bacteria | 1736 |
| 119 | JGI24702J35022_10026778 | 3300002462 | Bacteria | 3103 |
| 120 | JGI24705J35276_12237065 | 3300002504 | Bacteria | 9716 |
| 121 | Ga0068302_10256179 | 3300005071 | Bacteria | 2649 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042615 | Ga0466711_285268 | Ga0466711_285268_7886_8839 | 289 |
| 2 | 3300042601 | Ga0466707_041906 | Ga0466707_041906_478_1368 | 296 |
| 3 | 3300009826 | Ga0123355_10450784 | Ga0123355_104507842 | 298 |
| 4 | 3300042611 | Ga0466697_261085 | Ga0466697_261085_260_1162 | 300 |
| 5 | 3300042654 | Ga0466725_352811 | Ga0466725_352811_24_926 | 300 |
| 6 | 3300005201 | Ga0072941_1316839 | Ga0072941_13168392 | 301 |
| 7 | 3300009826 | Ga0123355_10181231 | Ga0123355_101812312 | 306 |
| 8 | 3300024493 | Ga0264413_134355 | Ga0264413_1343554 | 306 |
| 9 | 3300042619 | Ga0466726_219389 | Ga0466726_219389_4192_5130 | 312 |
| 10 | 3300010167 | Ga0123353_10046778 | Ga0123353_100467783 | 313 |
| 11 | 3300042601 | Ga0466707_181535 | Ga0466707_181535_5481_6428 | 315 |
| 12 | 3300042601 | Ga0466707_247194 | Ga0466707_247194_231_1178 | 315 |
| 13 | 3300042604 | Ga0466717_137840 | Ga0466717_137840_2948_3895 | 315 |
| 14 | 3300042643 | Ga0466704_537809 | Ga0466704_537809_3863_4810 | 315 |
| 15 | 3300042654 | Ga0466725_004350 | Ga0466725_004350_667_1614 | 315 |
| 16 | iso_pr_bacteria | 2820231849 | 2820232429 | 315 |
| 17 | iso_pr_bacteria | 2820318056 | 2820318511 | 315 |
| 18 | 2225789004 | 2227135538 | 2227534384 | 316 |
| 19 | 3300002462 | JGI24702J35022_10000321 | JGI24702J35022_100003217 | 316 |
| 20 | 3300009826 | Ga0123355_10000647 | Ga0123355_1000064740 | 316 |
| 21 | 3300010049 | Ga0123356_10113607 | Ga0123356_101136075 | 316 |
| 22 | 3300010049 | Ga0123356_10119201 | Ga0123356_101192013 | 316 |
| 23 | 3300010167 | Ga0123353_10238010 | Ga0123353_102380102 | 316 |
| 24 | 3300042601 | Ga0466707_330741 | Ga0466707_330741_7804_8754 | 316 |
| 25 | 3300042602 | Ga0466713_126310 | Ga0466713_126310_163_1113 | 316 |
| 26 | 3300042612 | Ga0466705_010343 | Ga0466705_010343_8138_9088 | 316 |
| 27 | 3300042616 | Ga0466715_460288 | Ga0466715_460288_2828_3778 | 316 |
| 28 | 3300042618 | Ga0466723_338262 | Ga0466723_338262_274_1224 | 316 |
| 29 | 3300042649 | Ga0466724_59476 | Ga0466724_59476_440_1390 | 316 |
| 30 | 3300000062 | IMNBL1DRAFT_c0003461 | IMNBL1DRAFT_00034612 | 317 |
| 31 | 3300009826 | Ga0123355_10004125 | Ga0123355_1000412512 | 317 |
| 32 | 3300009826 | Ga0123355_10175691 | Ga0123355_101756912 | 317 |
| 33 | 3300010049 | Ga0123356_10638219 | Ga0123356_106382192 | 317 |
| 34 | 3300010167 | Ga0123353_10121241 | Ga0123353_101212412 | 317 |
| 35 | 3300010167 | Ga0123353_10168669 | Ga0123353_101686693 | 317 |
| 36 | 3300010167 | Ga0123353_10739278 | Ga0123353_107392781 | 317 |
| 37 | 3300010882 | Ga0123354_10302991 | Ga0123354_103029912 | 317 |
| 38 | 3300042606 | Ga0466719_457446 | Ga0466719_457446_2526_3479 | 317 |
| 39 | 3300042606 | Ga0466719_529613 | Ga0466719_529613_179_1132 | 317 |
| 40 | 3300042612 | Ga0466705_026009 | Ga0466705_026009_176_1129 | 317 |
| 41 | 3300042655 | Ga0466727_242754 | Ga0466727_242754_25_978 | 317 |
| 42 | iso_pr_bacteria | 2781125685 | 2781417148 | 317 |
| 43 | 3300002462 | JGI24702J35022_10059761 | JGI24702J35022_100597612 | 318 |
| 44 | 3300002504 | JGI24705J35276_12188088 | JGI24705J35276_121880881 | 318 |
| 45 | 3300002504 | JGI24705J35276_12231759 | JGI24705J35276_122317592 | 318 |
| 46 | 3300009826 | Ga0123355_10110634 | Ga0123355_101106341 | 318 |
| 47 | 3300010049 | Ga0123356_10005273 | Ga0123356_100052739 | 318 |
| 48 | 3300010167 | Ga0123353_10280184 | Ga0123353_102801842 | 318 |
| 49 | 3300010167 | Ga0123353_10515683 | Ga0123353_105156832 | 318 |
| 50 | 3300010167 | Ga0123353_10602648 | Ga0123353_106026482 | 318 |
| 51 | 3300038395 | Ga0415639_002513 | Ga0415639_002513_6662_7618 | 318 |
| 52 | 3300038395 | Ga0415639_031875 | Ga0415639_031875_5273_6229 | 318 |
| 53 | iso_pr_bacteria | 2781125693 | 2781434485 | 318 |
| 54 | 3300002450 | JGI24695J34938_10010471 | JGI24695J34938_100104715 | 319 |
| 55 | 3300002450 | JGI24695J34938_10015409 | JGI24695J34938_100154093 | 319 |
| 56 | 3300002450 | JGI24695J34938_10041443 | JGI24695J34938_100414432 | 319 |
| 57 | 3300002450 | JGI24695J34938_10050963 | JGI24695J34938_100509632 | 319 |
| 58 | 3300002462 | JGI24702J35022_10135693 | JGI24702J35022_101356932 | 319 |
| 59 | 3300002504 | JGI24705J35276_12237065 | JGI24705J35276_122370652 | 319 |
| 60 | 3300009826 | Ga0123355_10226387 | Ga0123355_102263873 | 319 |
| 61 | 3300010167 | Ga0123353_10040763 | Ga0123353_100407636 | 319 |
| 62 | 3300042592 | Ga0466693_045657 | Ga0466693_045657_517_1476 | 319 |
| 63 | 3300042597 | Ga0466699_332664 | Ga0466699_332664_932_1891 | 319 |
| 64 | 3300042601 | Ga0466707_065326 | Ga0466707_065326_9134_10093 | 319 |
| 65 | 3300042601 | Ga0466707_218330 | Ga0466707_218330_41_1000 | 319 |
| 66 | 3300042654 | Ga0466725_016059 | Ga0466725_016059_5224_6183 | 319 |
| 67 | iso_pr_bacteria | 2781125694 | 2781435340 | 319 |
| 68 | 3300009826 | Ga0123355_10185820 | Ga0123355_101858203 | 320 |
| 69 | 3300010049 | Ga0123356_10004217 | Ga0123356_100042178 | 320 |
| 70 | 3300010049 | Ga0123356_10005093 | Ga0123356_100050937 | 320 |
| 71 | 3300010049 | Ga0123356_10050891 | Ga0123356_100508914 | 320 |
| 72 | 3300010049 | Ga0123356_10082155 | Ga0123356_100821552 | 320 |
| 73 | 3300010049 | Ga0123356_10353744 | Ga0123356_103537442 | 320 |
| 74 | 3300010167 | Ga0123353_10396339 | Ga0123353_103963392 | 320 |
| 75 | 3300038395 | Ga0415639_061286 | Ga0415639_061286_2782_3744 | 320 |
| 76 | 3300038395 | Ga0415639_181560 | Ga0415639_181560_477_1439 | 320 |
| 77 | 3300042602 | Ga0466713_062272 | Ga0466713_062272_22521_23483 | 320 |
| 78 | 3300042649 | Ga0466724_41336 | Ga0466724_41336_230_1192 | 320 |
| 79 | iso_pr_bacteria | 2820231849 | 2820232961 | 320 |
| 80 | iso_pr_bacteria | 2820620956 | 2820621874 | 320 |
| 81 | 3300002462 | JGI24702J35022_10000713 | JGI24702J35022_1000071314 | 321 |
| 82 | 3300002462 | JGI24702J35022_10026778 | JGI24702J35022_100267783 | 321 |
| 83 | 3300009826 | Ga0123355_10000903 | Ga0123355_1000090313 | 321 |
| 84 | 3300010167 | Ga0123353_10092185 | Ga0123353_100921853 | 321 |
| 85 | 3300010167 | Ga0123353_10111373 | Ga0123353_101113732 | 321 |
| 86 | 3300042592 | Ga0466693_373826 | Ga0466693_373826_1084_2049 | 321 |
| 87 | 3300042612 | Ga0466705_431940 | Ga0466705_431940_7782_8747 | 321 |
| 88 | 3300042619 | Ga0466726_128048 | Ga0466726_128048_4198_5163 | 321 |
| 89 | 3300042648 | Ga0466709_231608 | Ga0466709_231608_1143_2108 | 321 |
| 90 | 3300042652 | Ga0466708_423287 | Ga0466708_423287_332_1297 | 321 |
| 91 | iso_pr_bacteria | 2820432912 | 2820433482 | 321 |
| 92 | iso_pr_bacteria | 2820495292 | 2820495513 | 321 |
| 93 | 3300009826 | Ga0123355_10224312 | Ga0123355_102243122 | 322 |
| 94 | 3300042601 | Ga0466707_042142 | Ga0466707_042142_15977_16945 | 322 |
| 95 | 3300042601 | Ga0466707_051905 | Ga0466707_051905_16904_17872 | 322 |
| 96 | 3300042601 | Ga0466707_189805 | Ga0466707_189805_436_1404 | 322 |
| 97 | 3300042601 | Ga0466707_209014 | Ga0466707_209014_647_1615 | 322 |
| 98 | 3300042606 | Ga0466719_311711 | Ga0466719_311711_648_1616 | 322 |
| 99 | 3300042606 | Ga0466719_317446 | Ga0466719_317446_1030_1998 | 322 |
| 100 | 3300042612 | Ga0466705_079951 | Ga0466705_079951_446_1414 | 322 |
| 101 | 3300042618 | Ga0466723_102746 | Ga0466723_102746_17108_18076 | 322 |
| 102 | 3300042619 | Ga0466726_073859 | Ga0466726_073859_4794_5762 | 322 |
| 103 | iso_pr_bacteria | 2820001644 | 2820001914 | 322 |
| 104 | 3300042601 | Ga0466707_061437 | Ga0466707_061437_6310_7281 | 323 |
| 105 | 3300042601 | Ga0466707_353006 | Ga0466707_353006_118_1089 | 323 |
| 106 | 3300042618 | Ga0466723_248411 | Ga0466723_248411_6810_7781 | 323 |
| 107 | 3300010049 | Ga0123356_10166476 | Ga0123356_101664762 | 324 |
| 108 | 3300010167 | Ga0123353_10048222 | Ga0123353_100482225 | 324 |
| 109 | 3300009826 | Ga0123355_10041317 | Ga0123355_100413172 | 325 |
| 110 | 3300010167 | Ga0123353_10000021 | Ga0123353_1000002176 | 325 |
| 111 | 3300042602 | Ga0466713_033235 | Ga0466713_033235_966_1943 | 325 |
| 112 | 3300010049 | Ga0123356_10002219 | Ga0123356_100022196 | 326 |
| 113 | 3300009826 | Ga0123355_10004444 | Ga0123355_100044448 | 327 |
| 114 | iso_pr_bacteria | 2585428085 | 2587834776 | 327 |
| 115 | 3300009826 | Ga0123355_10222654 | Ga0123355_102226542 | 328 |
| 116 | 3300042619 | Ga0466726_158060 | Ga0466726_158060_511_1497 | 328 |
| 117 | iso_pr_bacteria | 2781125655 | 2781318771 | 328 |
| 118 | 3300009826 | Ga0123355_10004029 | Ga0123355_1000402919 | 329 |
| 119 | 3300009826 | Ga0123355_10010550 | Ga0123355_100105505 | 329 |
| 120 | 3300038395 | Ga0415639_035881 | Ga0415639_035881_773_1762 | 329 |
| 121 | 3300042612 | Ga0466705_525706 | Ga0466705_525706_2486_3475 | 329 |
| 122 | 3300042615 | Ga0466711_126361 | Ga0466711_126361_1306_2295 | 329 |
| 123 | 3300042618 | Ga0466723_032488 | Ga0466723_032488_682_1671 | 329 |
| 124 | 3300005071 | Ga0068302_10256179 | Ga0068302_102561792 | 330 |
| 125 | 3300009826 | Ga0123355_10393067 | Ga0123355_103930672 | 330 |
| 126 | 3300042601 | Ga0466707_015036 | Ga0466707_015036_10_1002 | 330 |
| 127 | 3300042648 | Ga0466709_392285 | Ga0466709_392285_145_1137 | 330 |
| 128 | 3300009826 | Ga0123355_10259215 | Ga0123355_102592151 | 332 |
| 129 | iso_pr_bacteria | 2819994798 | 2819997967 | 333 |
| 130 | 3300002508 | JGI24700J35501_10930869 | JGI24700J35501_1093086916 | 334 |
| 131 | 3300042612 | Ga0466705_236769 | Ga0466705_236769_198_1202 | 334 |
| 132 | 3300042654 | Ga0466725_007974 | Ga0466725_007974_89_1102 | 337 |
| 133 | 3300002450 | JGI24695J34938_10081821 | JGI24695J34938_100818211 | 348 |
| 134 | 3300010049 | Ga0123356_10117262 | Ga0123356_101172623 | 350 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.88 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.