Protein Family IF02799

Metagenome Isolate
258 Members
73 Samples
233 Scaffolds
371.31 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10101572|Ga0123356_101015722
Length
399 aa
Sequence
VIDKHPRLIYHKNNKFAEGCKGENMAALTILSTEGTVHDLLALGALVTRLDPGIIPFSQADDYRLHVSGGEYNVASNLSMCFRMRTAIASAIVDYPIGRKVELAVQKAGVTPYYKRFKHDGVRGPNMAIVWSDRGQGVRAPVVFYNRSNEAAQQLKPGSFDWEEIFGSAQKPKVRWFHSGGIFSALSPTTSELVIEAMQAAKKAGAVVSFDLNFRAKLWAIAAAEQGLTAEQAEEGAAKTLRKIAGFVDVLVGNEEDLQKGLGLKGQDVEAKSELDPAAFFGMIENVIKDFPNIKAVATTLREVYSTNRHSWSAVLWMDGKSYQAPVTDLDVYDRVGGGDGFASGLFYGLMTGKSPEESLRLGWAHGALLTTTPGDTSMVSRDQVEDFAKGGSARIQR*

πŸ“Š Sample Types

Isolate 9.7%
Metagenome 90.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 36.6%
Termitidae 33.8%
Kalotermitidae 19.7%
Rhinotermitidae 4.2%
Termopsidae 4.2%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 1
Bacteria 229
Eukaryota 0
Viruses 0
Unclassified 28

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
16 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
17 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
20 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
24 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
29 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
30 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
33 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
36 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
37 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
38 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
39 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
40 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
41 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
44 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
45 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
46 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
47 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
48 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
49 2228664001 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA Metagenome Termitidae
50 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
51 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
52 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
53 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
54 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
55 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
56 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
57 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
58 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
59 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
60 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
61 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
62 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
63 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
64 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
65 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
66 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
67 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
68 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
69 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
70 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
71 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
72 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
73 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_131210 3300024493 Bacteria 1257
2 Ga0466694_285058 3300042594 Unclassified 2404
3 Ga0466699_136781 3300042597 Bacteria 18861
4 Ga0123356_10101572 3300010049 Bacteria 2760
5 Ga0466706_013675 3300042599 Bacteria 3654
6 Ga0466716_052602 3300042605 Bacteria 5064
7 Ga0466716_133824 3300042605 Bacteria 2114
8 Ga0466720_056236 3300042607 Bacteria 7131
9 Ga0466720_074327 3300042607 Bacteria 5575
10 Ga0466720_199101 3300042607 Bacteria 4209
11 Ga0466722_006745 3300042609 Bacteria 29004
12 2230929952 2228664001 Bacteria 8070
13 JGI24698J34947_10054796 3300002449 Bacteria 1989
14 JGI24698J34947_10056109 3300002449 Bacteria 1960
15 JGI24695J34938_10000117 3300002450 Bacteria 71696
16 JGI24695J34938_10034516 3300002450 Bacteria 2321
17 Ga0466735_125413 3300042624 Bacteria 1815
18 Ga0466703_182941 3300042636 Bacteria 21148
19 Ga0466704_074771 3300042643 Bacteria 86016
20 Ga0466704_370295 3300042643 Bacteria 5314
21 Ga0466704_463123 3300042643 Bacteria 3902
22 Ga0466704_466222 3300042643 Bacteria 45364
23 Ga0466712_272619 3300042614 Bacteria 15936
24 Ga0466715_237867 3300042616 Bacteria 5312
25 Ga0466723_077145 3300042618 Bacteria 54484
26 Ga0466726_174006 3300042619 Bacteria 13818
27 Ga0466726_239328 3300042619 Bacteria 3235
28 Ga0466728_163235 3300042620 Unclassified 2004
29 Ga0466705_354466 3300042612 Bacteria 5097
30 Ga0264413_132941 3300024493 Unclassified 7301
31 Ga0466690_015418 3300042590 Bacteria 1626
32 Ga0466694_048641 3300042594 Bacteria 1291
33 Ga0466694_158510 3300042594 Bacteria 16066
34 Ga0466694_234568 3300042594 Bacteria 4323
35 Ga0466699_090778 3300042597 Bacteria 8302
36 Ga0466699_113752 3300042597 Bacteria 5250
37 Ga0123356_10083328 3300010049 Bacteria 3029
38 Ga0466700_163872 3300042600 Bacteria 1303
39 Ga0466720_022043 3300042607 Bacteria 4181
40 Ga0466722_026716 3300042609 Bacteria 9315
41 Ga0466722_188788 3300042609 Bacteria 22520
42 Ga0466698_045190 3300042610 Bacteria 4396
43 JGI24698J34947_10000275 3300002449 Bacteria 22092
44 JGI24698J34947_10001675 3300002449 Bacteria 11830
45 JGI24698J34947_10036325 3300002449 Unclassified 2566
46 JGI24695J34938_10001649 3300002450 Bacteria 18557
47 Ga0072940_1017020 3300005200 Bacteria 2911
48 Ga0072941_1083163 3300005201 Unclassified 2865
49 Ga0466703_296605 3300042636 Unclassified 2639
50 Ga0466712_037346 3300042614 Bacteria 6728
51 Ga0466712_137295 3300042614 Bacteria 31963
52 Ga0466712_160058 3300042614 Unclassified 2871
53 Ga0466712_287854 3300042614 Bacteria 4035
54 Ga0466718_099351 3300042617 Unclassified 1767
55 Ga0466728_120614 3300042620 Bacteria 5339
56 Ga0466692_111256 3300042591 Unclassified 4425
57 Ga0466691_215600 3300042593 Bacteria 5965
58 Ga0466696_058476 3300042596 Bacteria 2082
59 Ga0466699_172266 3300042597 Bacteria 1894
60 Ga0123357_10006128 3300009784 Bacteria 14575
61 Ga0123356_10004986 3300010049 Bacteria 13616
62 Ga0123353_10088583 3300010167 Archaea 4985
63 Ga0123353_10515644 3300010167 Bacteria 1737
64 Ga0123354_10285634 3300010882 Bacteria 1592
65 Ga0466720_033995 3300042607 Bacteria 12638
66 Ga0466722_241228 3300042609 Bacteria 14052
67 Ga0466698_039233 3300042610 Bacteria 3001
68 Ga0466698_444674 3300042610 Bacteria 2547
69 2230954210 2228664003 Bacteria 14264
70 AustNasuHG_c1000515 3300000089 Bacteria 13547
71 JGI24698J34947_10047760 3300002449 Unclassified 2171
72 JGI24695J34938_10008929 3300002450 Bacteria 5648
73 JGI24695J34938_10046684 3300002450 Bacteria 1916
74 Ga0466702_089215 3300042635 Bacteria 1177
75 Ga0466709_001833 3300042648 Bacteria 1451
76 Ga0466727_203807 3300042655 Unclassified 2224
77 Ga0466727_304506 3300042655 Bacteria 2056
78 Ga0466712_078232 3300042614 Bacteria 13492
79 Ga0466715_576520 3300042616 Bacteria 6975
80 Ga0466718_138193 3300042617 Bacteria 4024
81 Ga0466718_159827 3300042617 Unclassified 3405
82 Ga0466726_397232 3300042619 Bacteria 5945
83 Ga0264413_117074 3300024493 Bacteria 6930
84 Ga0466692_061185 3300042591 Bacteria 1200
85 Ga0466693_049301 3300042592 Bacteria 70349
86 Ga0466691_053455 3300042593 Bacteria 31332
87 Ga0466691_141739 3300042593 Bacteria 11905
88 Ga0466694_118856 3300042594 Bacteria 2383
89 Ga0466699_031938 3300042597 Bacteria 18041
90 Ga0466699_093380 3300042597 Bacteria 7870
91 Ga0466699_153573 3300042597 Bacteria 2335
92 Ga0123357_10014743 3300009784 Bacteria 10216
93 Ga0123356_10001871 3300010049 Bacteria 22804
94 Ga0123353_10089851 3300010167 Bacteria 4946
95 Ga0123353_10612525 3300010167 Bacteria 1553
96 Ga0466720_037818 3300042607 Unclassified 6720
97 Ga0466720_140465 3300042607 Bacteria 33994
98 Ga0466722_104507 3300042609 Bacteria 4138
99 AustNasuHG_c1004776 3300000089 Unclassified 4851
100 AustNasuHG_c1007562 3300000089 Bacteria 3858
101 JGI24698J34947_10019266 3300002449 Bacteria 3684
102 JGI24698J34947_10061498 3300002449 Unclassified 1848
103 JGI24695J34938_10001805 3300002450 Bacteria 17573
104 JGI24695J34938_10011746 3300002450 Bacteria 4697
105 Ga0466702_123089 3300042635 Bacteria 3179
106 Ga0466709_253354 3300042648 Bacteria 19722
107 Ga0466708_412872 3300042652 Bacteria 8340
108 Ga0466712_000857 3300042614 Bacteria 1698
109 Ga0466718_051418 3300042617 Bacteria 37100
110 Ga0466726_163971 3300042619 Bacteria 4040
111 Ga0466726_201791 3300042619 Bacteria 5585
112 Ga0466726_407422 3300042619 Bacteria 3685
113 Ga0466728_035631 3300042620 Bacteria 11868
114 Ga0466694_315116 3300042594 Bacteria 1677
115 Ga0466696_308011 3300042596 Bacteria 2836
116 Ga0466699_064095 3300042597 Bacteria 8170
117 Ga0466699_136580 3300042597 Bacteria 9927
118 Ga0466699_214427 3300042597 Bacteria 2196
119 Ga0123353_10142944 3300010167 Bacteria 3831
120 Ga0466719_026957 3300042606 Bacteria 5189
121 Ga0466720_106357 3300042607 Bacteria 7662
122 Ga0466720_123773 3300042607 Unclassified 2226
123 Ga0466720_162395 3300042607 Unclassified 3841
124 Ga0466722_108615 3300042609 Bacteria 2869
125 JGI24698J34947_10006713 3300002449 Unclassified 6321
126 JGI24698J34947_10053373 3300002449 Bacteria 2023
127 JGI24695J34938_10000004 3300002450 Bacteria 163071
128 JGI24695J34938_10000020 3300002450 Bacteria 112619
129 JGI24695J34938_10000734 3300002450 Bacteria 30892
130 JGI24695J34938_10001144 3300002450 Bacteria 23709
131 JGI24695J34938_10006160 3300002450 Bacteria 7296
132 Ga0072941_1015196 3300005201 Bacteria 40537
133 Ga0074263_100754 3300005485 Bacteria 3304
134 Ga0466731_163228 3300042622 Bacteria 1045
135 Ga0466703_058378 3300042636 Bacteria 4870
136 Ga0466709_127391 3300042648 Bacteria 23060
137 Ga0466727_172960 3300042655 Bacteria 16116
138 Ga0466718_135001 3300042617 Bacteria 3162
139 Ga0466723_152746 3300042618 Unclassified 7520
140 Ga0466732_241616 3300042656 Bacteria 3416
141 Ga0466690_070451 3300042590 Bacteria 8081
142 Ga0466692_058765 3300042591 Bacteria 30559
143 Ga0466692_172967 3300042591 Bacteria 17796
144 Ga0466691_015805 3300042593 Bacteria 4856
145 Ga0466694_161535 3300042594 Bacteria 25353
146 Ga0466699_426572 3300042597 Bacteria 2590
147 Ga0466716_489540 3300042605 Bacteria 1711
148 Ga0466719_119567 3300042606 Bacteria 21802
149 Ga0466719_198211 3300042606 Bacteria 9880
150 Ga0466720_062105 3300042607 Bacteria 20445
151 Ga0466720_069740 3300042607 Unclassified 3406
152 Ga0466720_214157 3300042607 Bacteria 15077
153 JGI24698J34947_10001221 3300002449 Bacteria 13433
154 JGI24698J34947_10002353 3300002449 Bacteria 10173
155 JGI24698J34947_10002564 3300002449 Bacteria 9803
156 JGI24698J34947_10038839 3300002449 Bacteria 2467
157 JGI24698J34947_10053588 3300002449 Bacteria 2018
158 JGI24695J34938_10002300 3300002450 Bacteria 14732
159 JGI24695J34938_10004837 3300002450 Bacteria 8651
160 JGI24695J34938_10008858 3300002450 Bacteria 5685
161 JGI24695J34938_10009925 3300002450 Bacteria 5256
162 JGI24695J34938_10029616 3300002450 Bacteria 2559
163 Ga0072941_1004233 3300005201 Bacteria 17241
164 Ga0466729_303004 3300042621 Bacteria 1718
165 Ga0466727_022362 3300042655 Bacteria 3012
166 Ga0466727_296098 3300042655 Bacteria 6877
167 Ga0466711_001519 3300042615 Bacteria 36988
168 Ga0466718_051431 3300042617 Unclassified 16917
169 Ga0466718_098740 3300042617 Bacteria 5661
170 Ga0466723_253681 3300042618 Bacteria 13574
171 Ga0466705_079814 3300042612 Bacteria 11344
172 Ga0466732_038889 3300042656 Bacteria 12032
173 Ga0466732_159206 3300042656 Bacteria 3423
174 Ga0466732_406836 3300042656 Bacteria 6521
175 Ga0466692_180850 3300042591 Bacteria 5241
176 Ga0466691_199951 3300042593 Bacteria 9060
177 Ga0466694_375754 3300042594 Bacteria 2752
178 Ga0466699_000784 3300042597 Bacteria 4213
179 Ga0466699_064802 3300042597 Bacteria 2768
180 Ga0466699_081089 3300042597 Bacteria 7922
181 Ga0466699_103440 3300042597 Bacteria 2414
182 Ga0466699_128115 3300042597 Bacteria 1752
183 Ga0466699_362070 3300042597 Bacteria 41569
184 Ga0123356_10002756 3300010049 Bacteria 18666
185 Ga0466707_012360 3300042601 Bacteria 1075
186 Ga0466716_096025 3300042605 Bacteria 4928
187 Ga0466720_007018 3300042607 Unclassified 7552
188 Ga0466720_012553 3300042607 Bacteria 8790
189 Ga0466720_044669 3300042607 Bacteria 23520
190 Ga0466720_075492 3300042607 Bacteria 12243
191 Ga0466721_052162 3300042608 Bacteria 30809
192 Ga0466698_362070 3300042610 Bacteria 9940
193 AustNasuHG_c1004857 3300000089 Bacteria 4811
194 JGI24698J34947_10005021 3300002449 Bacteria 7250
195 JGI24698J34947_10013494 3300002449 Bacteria 4460
196 JGI24695J34938_10011122 3300002450 Bacteria 4871
197 JGI24697J35500_11274794 3300002507 Bacteria 9882
198 Ga0072941_1012659 3300005201 Bacteria 17699
199 Ga0074263_103179 3300005485 Unclassified 1990
200 Ga0123357_10001858 3300009784 Bacteria 22927
201 Ga0466704_090220 3300042643 Bacteria 6410
202 Ga0466705_394194 3300042612 Bacteria 4534
203 Ga0466712_029911 3300042614 Bacteria 1981
204 Ga0466715_044599 3300042616 Bacteria 7110
205 Ga0466715_458996 3300042616 Bacteria 6415
206 Ga0466718_008313 3300042617 Unclassified 1960
207 Ga0466718_050323 3300042617 Bacteria 16197
208 Ga0466718_123072 3300042617 Bacteria 2834
209 Ga0466718_150572 3300042617 Unclassified 2523
210 Ga0466718_151758 3300042617 Unclassified 3227
211 Ga0466723_043246 3300042618 Bacteria 3590
212 Ga0466705_164747 3300042612 Bacteria 7292
213 Ga0264413_104902 3300024493 Bacteria 4001
214 Ga0466690_149179 3300042590 Bacteria 9626
215 Ga0466694_024239 3300042594 Bacteria 14266
216 Ga0466694_035844 3300042594 Bacteria 7459
217 Ga0466694_134638 3300042594 Bacteria 58679
218 Ga0466694_144664 3300042594 Bacteria 6041
219 Ga0466694_272807 3300042594 Bacteria 4374
220 Ga0466694_340777 3300042594 Bacteria 5682
221 Ga0123353_10333794 3300010167 Bacteria 2293
222 Ga0123353_10402987 3300010167 Unclassified 2035
223 Ga0466700_288474 3300042600 Unclassified 1266
224 Ga0466720_231134 3300042607 Bacteria 6542
225 JGI24698J34947_10001434 3300002449 Bacteria 12538
226 JGI24698J34947_10022240 3300002449 Bacteria 3404
227 JGI24695J34938_10000617 3300002450 Bacteria 33886
228 Ga0466702_123184 3300042635 Bacteria 6773
229 Ga0466712_010679 3300042614 Bacteria 17309
230 Ga0466718_045446 3300042617 Bacteria 7041
231 Ga0466723_161549 3300042618 Bacteria 19612
232 Ga0466726_106038 3300042619 Bacteria 1630
233 Ga0466726_426964 3300042619 Bacteria 7655

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00294 PfkB pfkB family carbohydrate kinase 60 379 0.77

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.