Protein Family IF02799
Metagenome
Isolate
258
Members
73
Samples
233
Scaffolds
371.31
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10101572|Ga0123356_101015722
- Length
- 399 aa
- Sequence
- VIDKHPRLIYHKNNKFAEGCKGENMAALTILSTEGTVHDLLALGALVTRLDPGIIPFSQADDYRLHVSGGEYNVASNLSMCFRMRTAIASAIVDYPIGRKVELAVQKAGVTPYYKRFKHDGVRGPNMAIVWSDRGQGVRAPVVFYNRSNEAAQQLKPGSFDWEEIFGSAQKPKVRWFHSGGIFSALSPTTSELVIEAMQAAKKAGAVVSFDLNFRAKLWAIAAAEQGLTAEQAEEGAAKTLRKIAGFVDVLVGNEEDLQKGLGLKGQDVEAKSELDPAAFFGMIENVIKDFPNIKAVATTLREVYSTNRHSWSAVLWMDGKSYQAPVTDLDVYDRVGGGDGFASGLFYGLMTGKSPEESLRLGWAHGALLTTTPGDTSMVSRDQVEDFAKGGSARIQR*
Sample Types
Isolate
9.7%
Metagenome
90.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
36.6%
Termitidae
33.8%
Kalotermitidae
19.7%
Rhinotermitidae
4.2%
Termopsidae
4.2%
Hodotermitidae
1.4%
Taxonomy
Archaea
1
Bacteria
229
Eukaryota
0
Viruses
0
Unclassified
28
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 2 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 16 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 17 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 18 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 19 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 20 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 24 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 29 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 30 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 36 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 37 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 38 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 39 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 40 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 41 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 46 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 47 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 50 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 51 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 52 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 53 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 54 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 55 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 56 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 57 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 58 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 59 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 60 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 61 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 62 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 63 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 64 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 65 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 66 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 67 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 68 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 69 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_131210 | 3300024493 | Bacteria | 1257 |
| 2 | Ga0466694_285058 | 3300042594 | Unclassified | 2404 |
| 3 | Ga0466699_136781 | 3300042597 | Bacteria | 18861 |
| 4 | Ga0123356_10101572 | 3300010049 | Bacteria | 2760 |
| 5 | Ga0466706_013675 | 3300042599 | Bacteria | 3654 |
| 6 | Ga0466716_052602 | 3300042605 | Bacteria | 5064 |
| 7 | Ga0466716_133824 | 3300042605 | Bacteria | 2114 |
| 8 | Ga0466720_056236 | 3300042607 | Bacteria | 7131 |
| 9 | Ga0466720_074327 | 3300042607 | Bacteria | 5575 |
| 10 | Ga0466720_199101 | 3300042607 | Bacteria | 4209 |
| 11 | Ga0466722_006745 | 3300042609 | Bacteria | 29004 |
| 12 | 2230929952 | 2228664001 | Bacteria | 8070 |
| 13 | JGI24698J34947_10054796 | 3300002449 | Bacteria | 1989 |
| 14 | JGI24698J34947_10056109 | 3300002449 | Bacteria | 1960 |
| 15 | JGI24695J34938_10000117 | 3300002450 | Bacteria | 71696 |
| 16 | JGI24695J34938_10034516 | 3300002450 | Bacteria | 2321 |
| 17 | Ga0466735_125413 | 3300042624 | Bacteria | 1815 |
| 18 | Ga0466703_182941 | 3300042636 | Bacteria | 21148 |
| 19 | Ga0466704_074771 | 3300042643 | Bacteria | 86016 |
| 20 | Ga0466704_370295 | 3300042643 | Bacteria | 5314 |
| 21 | Ga0466704_463123 | 3300042643 | Bacteria | 3902 |
| 22 | Ga0466704_466222 | 3300042643 | Bacteria | 45364 |
| 23 | Ga0466712_272619 | 3300042614 | Bacteria | 15936 |
| 24 | Ga0466715_237867 | 3300042616 | Bacteria | 5312 |
| 25 | Ga0466723_077145 | 3300042618 | Bacteria | 54484 |
| 26 | Ga0466726_174006 | 3300042619 | Bacteria | 13818 |
| 27 | Ga0466726_239328 | 3300042619 | Bacteria | 3235 |
| 28 | Ga0466728_163235 | 3300042620 | Unclassified | 2004 |
| 29 | Ga0466705_354466 | 3300042612 | Bacteria | 5097 |
| 30 | Ga0264413_132941 | 3300024493 | Unclassified | 7301 |
| 31 | Ga0466690_015418 | 3300042590 | Bacteria | 1626 |
| 32 | Ga0466694_048641 | 3300042594 | Bacteria | 1291 |
| 33 | Ga0466694_158510 | 3300042594 | Bacteria | 16066 |
| 34 | Ga0466694_234568 | 3300042594 | Bacteria | 4323 |
| 35 | Ga0466699_090778 | 3300042597 | Bacteria | 8302 |
| 36 | Ga0466699_113752 | 3300042597 | Bacteria | 5250 |
| 37 | Ga0123356_10083328 | 3300010049 | Bacteria | 3029 |
| 38 | Ga0466700_163872 | 3300042600 | Bacteria | 1303 |
| 39 | Ga0466720_022043 | 3300042607 | Bacteria | 4181 |
| 40 | Ga0466722_026716 | 3300042609 | Bacteria | 9315 |
| 41 | Ga0466722_188788 | 3300042609 | Bacteria | 22520 |
| 42 | Ga0466698_045190 | 3300042610 | Bacteria | 4396 |
| 43 | JGI24698J34947_10000275 | 3300002449 | Bacteria | 22092 |
| 44 | JGI24698J34947_10001675 | 3300002449 | Bacteria | 11830 |
| 45 | JGI24698J34947_10036325 | 3300002449 | Unclassified | 2566 |
| 46 | JGI24695J34938_10001649 | 3300002450 | Bacteria | 18557 |
| 47 | Ga0072940_1017020 | 3300005200 | Bacteria | 2911 |
| 48 | Ga0072941_1083163 | 3300005201 | Unclassified | 2865 |
| 49 | Ga0466703_296605 | 3300042636 | Unclassified | 2639 |
| 50 | Ga0466712_037346 | 3300042614 | Bacteria | 6728 |
| 51 | Ga0466712_137295 | 3300042614 | Bacteria | 31963 |
| 52 | Ga0466712_160058 | 3300042614 | Unclassified | 2871 |
| 53 | Ga0466712_287854 | 3300042614 | Bacteria | 4035 |
| 54 | Ga0466718_099351 | 3300042617 | Unclassified | 1767 |
| 55 | Ga0466728_120614 | 3300042620 | Bacteria | 5339 |
| 56 | Ga0466692_111256 | 3300042591 | Unclassified | 4425 |
| 57 | Ga0466691_215600 | 3300042593 | Bacteria | 5965 |
| 58 | Ga0466696_058476 | 3300042596 | Bacteria | 2082 |
| 59 | Ga0466699_172266 | 3300042597 | Bacteria | 1894 |
| 60 | Ga0123357_10006128 | 3300009784 | Bacteria | 14575 |
| 61 | Ga0123356_10004986 | 3300010049 | Bacteria | 13616 |
| 62 | Ga0123353_10088583 | 3300010167 | Archaea | 4985 |
| 63 | Ga0123353_10515644 | 3300010167 | Bacteria | 1737 |
| 64 | Ga0123354_10285634 | 3300010882 | Bacteria | 1592 |
| 65 | Ga0466720_033995 | 3300042607 | Bacteria | 12638 |
| 66 | Ga0466722_241228 | 3300042609 | Bacteria | 14052 |
| 67 | Ga0466698_039233 | 3300042610 | Bacteria | 3001 |
| 68 | Ga0466698_444674 | 3300042610 | Bacteria | 2547 |
| 69 | 2230954210 | 2228664003 | Bacteria | 14264 |
| 70 | AustNasuHG_c1000515 | 3300000089 | Bacteria | 13547 |
| 71 | JGI24698J34947_10047760 | 3300002449 | Unclassified | 2171 |
| 72 | JGI24695J34938_10008929 | 3300002450 | Bacteria | 5648 |
| 73 | JGI24695J34938_10046684 | 3300002450 | Bacteria | 1916 |
| 74 | Ga0466702_089215 | 3300042635 | Bacteria | 1177 |
| 75 | Ga0466709_001833 | 3300042648 | Bacteria | 1451 |
| 76 | Ga0466727_203807 | 3300042655 | Unclassified | 2224 |
| 77 | Ga0466727_304506 | 3300042655 | Bacteria | 2056 |
| 78 | Ga0466712_078232 | 3300042614 | Bacteria | 13492 |
| 79 | Ga0466715_576520 | 3300042616 | Bacteria | 6975 |
| 80 | Ga0466718_138193 | 3300042617 | Bacteria | 4024 |
| 81 | Ga0466718_159827 | 3300042617 | Unclassified | 3405 |
| 82 | Ga0466726_397232 | 3300042619 | Bacteria | 5945 |
| 83 | Ga0264413_117074 | 3300024493 | Bacteria | 6930 |
| 84 | Ga0466692_061185 | 3300042591 | Bacteria | 1200 |
| 85 | Ga0466693_049301 | 3300042592 | Bacteria | 70349 |
| 86 | Ga0466691_053455 | 3300042593 | Bacteria | 31332 |
| 87 | Ga0466691_141739 | 3300042593 | Bacteria | 11905 |
| 88 | Ga0466694_118856 | 3300042594 | Bacteria | 2383 |
| 89 | Ga0466699_031938 | 3300042597 | Bacteria | 18041 |
| 90 | Ga0466699_093380 | 3300042597 | Bacteria | 7870 |
| 91 | Ga0466699_153573 | 3300042597 | Bacteria | 2335 |
| 92 | Ga0123357_10014743 | 3300009784 | Bacteria | 10216 |
| 93 | Ga0123356_10001871 | 3300010049 | Bacteria | 22804 |
| 94 | Ga0123353_10089851 | 3300010167 | Bacteria | 4946 |
| 95 | Ga0123353_10612525 | 3300010167 | Bacteria | 1553 |
| 96 | Ga0466720_037818 | 3300042607 | Unclassified | 6720 |
| 97 | Ga0466720_140465 | 3300042607 | Bacteria | 33994 |
| 98 | Ga0466722_104507 | 3300042609 | Bacteria | 4138 |
| 99 | AustNasuHG_c1004776 | 3300000089 | Unclassified | 4851 |
| 100 | AustNasuHG_c1007562 | 3300000089 | Bacteria | 3858 |
| 101 | JGI24698J34947_10019266 | 3300002449 | Bacteria | 3684 |
| 102 | JGI24698J34947_10061498 | 3300002449 | Unclassified | 1848 |
| 103 | JGI24695J34938_10001805 | 3300002450 | Bacteria | 17573 |
| 104 | JGI24695J34938_10011746 | 3300002450 | Bacteria | 4697 |
| 105 | Ga0466702_123089 | 3300042635 | Bacteria | 3179 |
| 106 | Ga0466709_253354 | 3300042648 | Bacteria | 19722 |
| 107 | Ga0466708_412872 | 3300042652 | Bacteria | 8340 |
| 108 | Ga0466712_000857 | 3300042614 | Bacteria | 1698 |
| 109 | Ga0466718_051418 | 3300042617 | Bacteria | 37100 |
| 110 | Ga0466726_163971 | 3300042619 | Bacteria | 4040 |
| 111 | Ga0466726_201791 | 3300042619 | Bacteria | 5585 |
| 112 | Ga0466726_407422 | 3300042619 | Bacteria | 3685 |
| 113 | Ga0466728_035631 | 3300042620 | Bacteria | 11868 |
| 114 | Ga0466694_315116 | 3300042594 | Bacteria | 1677 |
| 115 | Ga0466696_308011 | 3300042596 | Bacteria | 2836 |
| 116 | Ga0466699_064095 | 3300042597 | Bacteria | 8170 |
| 117 | Ga0466699_136580 | 3300042597 | Bacteria | 9927 |
| 118 | Ga0466699_214427 | 3300042597 | Bacteria | 2196 |
| 119 | Ga0123353_10142944 | 3300010167 | Bacteria | 3831 |
| 120 | Ga0466719_026957 | 3300042606 | Bacteria | 5189 |
| 121 | Ga0466720_106357 | 3300042607 | Bacteria | 7662 |
| 122 | Ga0466720_123773 | 3300042607 | Unclassified | 2226 |
| 123 | Ga0466720_162395 | 3300042607 | Unclassified | 3841 |
| 124 | Ga0466722_108615 | 3300042609 | Bacteria | 2869 |
| 125 | JGI24698J34947_10006713 | 3300002449 | Unclassified | 6321 |
| 126 | JGI24698J34947_10053373 | 3300002449 | Bacteria | 2023 |
| 127 | JGI24695J34938_10000004 | 3300002450 | Bacteria | 163071 |
| 128 | JGI24695J34938_10000020 | 3300002450 | Bacteria | 112619 |
| 129 | JGI24695J34938_10000734 | 3300002450 | Bacteria | 30892 |
| 130 | JGI24695J34938_10001144 | 3300002450 | Bacteria | 23709 |
| 131 | JGI24695J34938_10006160 | 3300002450 | Bacteria | 7296 |
| 132 | Ga0072941_1015196 | 3300005201 | Bacteria | 40537 |
| 133 | Ga0074263_100754 | 3300005485 | Bacteria | 3304 |
| 134 | Ga0466731_163228 | 3300042622 | Bacteria | 1045 |
| 135 | Ga0466703_058378 | 3300042636 | Bacteria | 4870 |
| 136 | Ga0466709_127391 | 3300042648 | Bacteria | 23060 |
| 137 | Ga0466727_172960 | 3300042655 | Bacteria | 16116 |
| 138 | Ga0466718_135001 | 3300042617 | Bacteria | 3162 |
| 139 | Ga0466723_152746 | 3300042618 | Unclassified | 7520 |
| 140 | Ga0466732_241616 | 3300042656 | Bacteria | 3416 |
| 141 | Ga0466690_070451 | 3300042590 | Bacteria | 8081 |
| 142 | Ga0466692_058765 | 3300042591 | Bacteria | 30559 |
| 143 | Ga0466692_172967 | 3300042591 | Bacteria | 17796 |
| 144 | Ga0466691_015805 | 3300042593 | Bacteria | 4856 |
| 145 | Ga0466694_161535 | 3300042594 | Bacteria | 25353 |
| 146 | Ga0466699_426572 | 3300042597 | Bacteria | 2590 |
| 147 | Ga0466716_489540 | 3300042605 | Bacteria | 1711 |
| 148 | Ga0466719_119567 | 3300042606 | Bacteria | 21802 |
| 149 | Ga0466719_198211 | 3300042606 | Bacteria | 9880 |
| 150 | Ga0466720_062105 | 3300042607 | Bacteria | 20445 |
| 151 | Ga0466720_069740 | 3300042607 | Unclassified | 3406 |
| 152 | Ga0466720_214157 | 3300042607 | Bacteria | 15077 |
| 153 | JGI24698J34947_10001221 | 3300002449 | Bacteria | 13433 |
| 154 | JGI24698J34947_10002353 | 3300002449 | Bacteria | 10173 |
| 155 | JGI24698J34947_10002564 | 3300002449 | Bacteria | 9803 |
| 156 | JGI24698J34947_10038839 | 3300002449 | Bacteria | 2467 |
| 157 | JGI24698J34947_10053588 | 3300002449 | Bacteria | 2018 |
| 158 | JGI24695J34938_10002300 | 3300002450 | Bacteria | 14732 |
| 159 | JGI24695J34938_10004837 | 3300002450 | Bacteria | 8651 |
| 160 | JGI24695J34938_10008858 | 3300002450 | Bacteria | 5685 |
| 161 | JGI24695J34938_10009925 | 3300002450 | Bacteria | 5256 |
| 162 | JGI24695J34938_10029616 | 3300002450 | Bacteria | 2559 |
| 163 | Ga0072941_1004233 | 3300005201 | Bacteria | 17241 |
| 164 | Ga0466729_303004 | 3300042621 | Bacteria | 1718 |
| 165 | Ga0466727_022362 | 3300042655 | Bacteria | 3012 |
| 166 | Ga0466727_296098 | 3300042655 | Bacteria | 6877 |
| 167 | Ga0466711_001519 | 3300042615 | Bacteria | 36988 |
| 168 | Ga0466718_051431 | 3300042617 | Unclassified | 16917 |
| 169 | Ga0466718_098740 | 3300042617 | Bacteria | 5661 |
| 170 | Ga0466723_253681 | 3300042618 | Bacteria | 13574 |
| 171 | Ga0466705_079814 | 3300042612 | Bacteria | 11344 |
| 172 | Ga0466732_038889 | 3300042656 | Bacteria | 12032 |
| 173 | Ga0466732_159206 | 3300042656 | Bacteria | 3423 |
| 174 | Ga0466732_406836 | 3300042656 | Bacteria | 6521 |
| 175 | Ga0466692_180850 | 3300042591 | Bacteria | 5241 |
| 176 | Ga0466691_199951 | 3300042593 | Bacteria | 9060 |
| 177 | Ga0466694_375754 | 3300042594 | Bacteria | 2752 |
| 178 | Ga0466699_000784 | 3300042597 | Bacteria | 4213 |
| 179 | Ga0466699_064802 | 3300042597 | Bacteria | 2768 |
| 180 | Ga0466699_081089 | 3300042597 | Bacteria | 7922 |
| 181 | Ga0466699_103440 | 3300042597 | Bacteria | 2414 |
| 182 | Ga0466699_128115 | 3300042597 | Bacteria | 1752 |
| 183 | Ga0466699_362070 | 3300042597 | Bacteria | 41569 |
| 184 | Ga0123356_10002756 | 3300010049 | Bacteria | 18666 |
| 185 | Ga0466707_012360 | 3300042601 | Bacteria | 1075 |
| 186 | Ga0466716_096025 | 3300042605 | Bacteria | 4928 |
| 187 | Ga0466720_007018 | 3300042607 | Unclassified | 7552 |
| 188 | Ga0466720_012553 | 3300042607 | Bacteria | 8790 |
| 189 | Ga0466720_044669 | 3300042607 | Bacteria | 23520 |
| 190 | Ga0466720_075492 | 3300042607 | Bacteria | 12243 |
| 191 | Ga0466721_052162 | 3300042608 | Bacteria | 30809 |
| 192 | Ga0466698_362070 | 3300042610 | Bacteria | 9940 |
| 193 | AustNasuHG_c1004857 | 3300000089 | Bacteria | 4811 |
| 194 | JGI24698J34947_10005021 | 3300002449 | Bacteria | 7250 |
| 195 | JGI24698J34947_10013494 | 3300002449 | Bacteria | 4460 |
| 196 | JGI24695J34938_10011122 | 3300002450 | Bacteria | 4871 |
| 197 | JGI24697J35500_11274794 | 3300002507 | Bacteria | 9882 |
| 198 | Ga0072941_1012659 | 3300005201 | Bacteria | 17699 |
| 199 | Ga0074263_103179 | 3300005485 | Unclassified | 1990 |
| 200 | Ga0123357_10001858 | 3300009784 | Bacteria | 22927 |
| 201 | Ga0466704_090220 | 3300042643 | Bacteria | 6410 |
| 202 | Ga0466705_394194 | 3300042612 | Bacteria | 4534 |
| 203 | Ga0466712_029911 | 3300042614 | Bacteria | 1981 |
| 204 | Ga0466715_044599 | 3300042616 | Bacteria | 7110 |
| 205 | Ga0466715_458996 | 3300042616 | Bacteria | 6415 |
| 206 | Ga0466718_008313 | 3300042617 | Unclassified | 1960 |
| 207 | Ga0466718_050323 | 3300042617 | Bacteria | 16197 |
| 208 | Ga0466718_123072 | 3300042617 | Bacteria | 2834 |
| 209 | Ga0466718_150572 | 3300042617 | Unclassified | 2523 |
| 210 | Ga0466718_151758 | 3300042617 | Unclassified | 3227 |
| 211 | Ga0466723_043246 | 3300042618 | Bacteria | 3590 |
| 212 | Ga0466705_164747 | 3300042612 | Bacteria | 7292 |
| 213 | Ga0264413_104902 | 3300024493 | Bacteria | 4001 |
| 214 | Ga0466690_149179 | 3300042590 | Bacteria | 9626 |
| 215 | Ga0466694_024239 | 3300042594 | Bacteria | 14266 |
| 216 | Ga0466694_035844 | 3300042594 | Bacteria | 7459 |
| 217 | Ga0466694_134638 | 3300042594 | Bacteria | 58679 |
| 218 | Ga0466694_144664 | 3300042594 | Bacteria | 6041 |
| 219 | Ga0466694_272807 | 3300042594 | Bacteria | 4374 |
| 220 | Ga0466694_340777 | 3300042594 | Bacteria | 5682 |
| 221 | Ga0123353_10333794 | 3300010167 | Bacteria | 2293 |
| 222 | Ga0123353_10402987 | 3300010167 | Unclassified | 2035 |
| 223 | Ga0466700_288474 | 3300042600 | Unclassified | 1266 |
| 224 | Ga0466720_231134 | 3300042607 | Bacteria | 6542 |
| 225 | JGI24698J34947_10001434 | 3300002449 | Bacteria | 12538 |
| 226 | JGI24698J34947_10022240 | 3300002449 | Bacteria | 3404 |
| 227 | JGI24695J34938_10000617 | 3300002450 | Bacteria | 33886 |
| 228 | Ga0466702_123184 | 3300042635 | Bacteria | 6773 |
| 229 | Ga0466712_010679 | 3300042614 | Bacteria | 17309 |
| 230 | Ga0466718_045446 | 3300042617 | Bacteria | 7041 |
| 231 | Ga0466723_161549 | 3300042618 | Bacteria | 19612 |
| 232 | Ga0466726_106038 | 3300042619 | Bacteria | 1630 |
| 233 | Ga0466726_426964 | 3300042619 | Bacteria | 7655 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00294 | PfkB | pfkB family carbohydrate kinase | 60 | 379 | 0.77 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.