Protein Family IF02792
Metagenome
Isolate
132
Members
68
Samples
112
Scaffolds
337.56
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10094050|Ga0123356_100940501
- Length
- 383 aa
- Sequence
- MMKKKAKIYVAGHTGLVGSAILKNLQQRGYKNFVLRTIEELDLTDQNAVAAFFECEKPEYVILAAAKVGGIVANNTYRADFIYENLMIQNNVIHQSYRNGVKKLVFLGSTCIYPKEANQPMKETELLTNPLEYTNEPYAIAKIAGIKMCESYNLQYGTNFIAVMPTNLYGPNDNFNLETSHVLPALIRKIHLGKCLENRDMRAIKIDLDKRPIEGIDGKSPESEIFDILEKYGMKRLPNGKVQIEIWGTGNPRREFLWSEEMADATVYIMERINFSDITASAHNVRAGLAPAPIRNTHINVGTGKDISIVEIACLIKEKTGFNGNLWFNSEKPDGTMKKLTDVSKLHSLGWRHKIEIDEGVELLYDWYLCASTSVNTTDTAR*
Sample Types
Isolate
15.2%
Metagenome
84.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Kalotermitidae
18.2%
Blattidae
13.6%
Unclassified
10.6%
Termopsidae
4.5%
Rhinotermitidae
4.5%
Culicidae
3.0%
Hydrophilidae
3.0%
Drosophilidae
1.5%
Tenebrionidae
1.5%
Muscidae
1.5%
Armadillidiidae
1.5%
Daphniidae
1.5%
Passalidae
1.5%
Taxonomy
Archaea
0
Bacteria
125
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 2 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 3 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 4 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 5 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 6 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 7 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 8 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 9 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 10 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 11 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 12 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 13 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 21 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 22 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 23 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 24 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 28 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 29 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 30 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 33 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 34 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 35 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 36 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 37 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 38 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 39 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 44 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 45 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 46 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 47 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 49 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 50 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 51 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 52 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 53 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 54 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 55 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 56 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 57 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 58 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 59 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 60 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 61 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 62 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 63 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 64 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 65 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 66 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 67 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 68 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_115205 | 3300042612 | Bacteria | 20678 |
| 2 | Ga0466733_078995 | 3300042659 | Bacteria | 4690 |
| 3 | Ga0466711_264493 | 3300042615 | Bacteria | 3179 |
| 4 | Ga0466715_160067 | 3300042616 | Bacteria | 3578 |
| 5 | Ga0466713_020269 | 3300042602 | Bacteria | 1166 |
| 6 | Ga0466713_094496 | 3300042602 | Bacteria | 333875 |
| 7 | Ga0466713_119550 | 3300042602 | Bacteria | 166583 |
| 8 | Ga0466713_141379 | 3300042602 | Bacteria | 226907 |
| 9 | Ga0123356_10152436 | 3300010049 | Bacteria | 2297 |
| 10 | Ga0160471_100014 | 3300012812 | Bacteria | 410119 |
| 11 | Ga0160471_101272 | 3300012812 | Bacteria | 5221 |
| 12 | Ga0466735_160523 | 3300042624 | Bacteria | 1741 |
| 13 | Ga0466704_312982 | 3300042643 | Bacteria | 1663 |
| 14 | Ga0466704_473464 | 3300042643 | Unclassified | 2464 |
| 15 | Ga0466709_402849 | 3300042648 | Bacteria | 45308 |
| 16 | Ga0466690_307633 | 3300042590 | Bacteria | 1524 |
| 17 | Ga0466690_311035 | 3300042590 | Bacteria | 2255 |
| 18 | Ga0068305_10004723 | 3300005083 | Bacteria | 26648 |
| 19 | Ga0072941_1036272 | 3300005201 | Unclassified | 8963 |
| 20 | Ga0466705_384234 | 3300042612 | Bacteria | 2163 |
| 21 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 22 | Ga0466726_224367 | 3300042619 | Bacteria | 2976 |
| 23 | Ga0466698_406875 | 3300042610 | Unclassified | 1618 |
| 24 | Ga0466734_054818 | 3300042623 | Bacteria | 2290 |
| 25 | Ga0466704_156297 | 3300042643 | Bacteria | 3302 |
| 26 | IMNBL1DRAFT_c0027745 | 3300000062 | Unclassified | 2123 |
| 27 | JGI24702J35022_10024358 | 3300002462 | Bacteria | 3271 |
| 28 | Ga0104045_1019850 | 3300007085 | Bacteria | 2733 |
| 29 | Ga0466705_048987 | 3300042612 | Bacteria | 8011 |
| 30 | Ga0466711_013308 | 3300042615 | Bacteria | 11812 |
| 31 | Ga0466713_102919 | 3300042602 | Bacteria | 4108 |
| 32 | Ga0123355_10071872 | 3300009826 | Bacteria | 5552 |
| 33 | Ga0466708_437948 | 3300042652 | Bacteria | 2925 |
| 34 | Ga0466696_328638 | 3300042596 | Bacteria | 21209 |
| 35 | JGI24698J34947_10000739 | 3300002449 | Bacteria | 16118 |
| 36 | JGI24698J34947_10002776 | 3300002449 | Bacteria | 9481 |
| 37 | JGI24696J40584_12961543 | 3300002834 | Bacteria | 20311 |
| 38 | Ga0466705_295415 | 3300042612 | Bacteria | 9760 |
| 39 | Ga0466733_023171 | 3300042659 | Bacteria | 6220 |
| 40 | Ga0466733_219421 | 3300042659 | Bacteria | 19732 |
| 41 | Ga0466705_480992 | 3300042612 | Bacteria | 29080 |
| 42 | Ga0466715_168143 | 3300042616 | Bacteria | 23764 |
| 43 | Ga0466715_514350 | 3300042616 | Bacteria | 10134 |
| 44 | Ga0466723_113612 | 3300042618 | Bacteria | 2237 |
| 45 | Ga0466700_048707 | 3300042600 | Bacteria | 13808 |
| 46 | Ga0466707_126179 | 3300042601 | Bacteria | 55735 |
| 47 | Ga0466714_101779 | 3300042603 | Bacteria | 2270 |
| 48 | Ga0123357_10026224 | 3300009784 | Bacteria | 7872 |
| 49 | Ga0123353_10296437 | 3300010167 | Bacteria | 2472 |
| 50 | Ga0123354_10000946 | 3300010882 | Bacteria | 32774 |
| 51 | Ga0466735_196511 | 3300042624 | Bacteria | 2846 |
| 52 | Ga0466690_021486 | 3300042590 | Bacteria | 6610 |
| 53 | Ga0466691_035750 | 3300042593 | Bacteria | 8416 |
| 54 | JGI24705J35276_12236200 | 3300002504 | Bacteria | 7637 |
| 55 | Ga0466697_127737 | 3300042611 | Bacteria | 3390 |
| 56 | Ga0466705_437719 | 3300042612 | Bacteria | 1458 |
| 57 | Ga0466715_268887 | 3300042616 | Bacteria | 6599 |
| 58 | Ga0466700_303231 | 3300042600 | Bacteria | 1854 |
| 59 | Ga0466713_101204 | 3300042602 | Bacteria | 5601 |
| 60 | Ga0466734_135833 | 3300042623 | Bacteria | 1814 |
| 61 | Ga0466730_053547 | 3300042625 | Bacteria | 2164 |
| 62 | Ga0466704_582273 | 3300042643 | Bacteria | 41967 |
| 63 | Ga0466725_007379 | 3300042654 | Bacteria | 6632 |
| 64 | Ga0466727_083821 | 3300042655 | Bacteria | 1233 |
| 65 | Ga0160443_100200 | 3300012848 | Bacteria | 77772 |
| 66 | Ga0466657_386327 | 3300042582 | Bacteria | 2845 |
| 67 | Ga0466696_304445 | 3300042596 | Bacteria | 2212 |
| 68 | JGI24698J34947_10001956 | 3300002449 | Bacteria | 10988 |
| 69 | Ga0466728_225673 | 3300042620 | Bacteria | 6340 |
| 70 | Ga0466700_017485 | 3300042600 | Bacteria | 1688 |
| 71 | Ga0466713_070638 | 3300042602 | Bacteria | 14478 |
| 72 | Ga0466714_011055 | 3300042603 | Bacteria | 2037 |
| 73 | Ga0466717_270802 | 3300042604 | Bacteria | 3205 |
| 74 | Ga0123357_10093020 | 3300009784 | Bacteria | 3920 |
| 75 | Ga0123357_10106610 | 3300009784 | Bacteria | 3591 |
| 76 | Ga0123356_10100968 | 3300010049 | Bacteria | 2767 |
| 77 | Ga0123353_10006045 | 3300010167 | Bacteria | 16039 |
| 78 | Ga0123354_10053811 | 3300010882 | Bacteria | 6049 |
| 79 | Ga0466729_294209 | 3300042621 | Bacteria | 1256 |
| 80 | Ga0466704_065939 | 3300042643 | Bacteria | 10142 |
| 81 | Ga0466709_349119 | 3300042648 | Bacteria | 16327 |
| 82 | Ga0264413_144475 | 3300024493 | Bacteria | 6139 |
| 83 | Ga0415639_080526 | 3300038395 | Bacteria | 10285 |
| 84 | Ga0466691_075164 | 3300042593 | Bacteria | 3771 |
| 85 | Ga0466701_011297 | 3300042598 | Bacteria | 12166 |
| 86 | Ga0466705_126639 | 3300042612 | Unclassified | 1765 |
| 87 | Ga0466705_377004 | 3300042612 | Bacteria | 1875 |
| 88 | Ga0466733_146809 | 3300042659 | Bacteria | 1883 |
| 89 | Ga0466715_120204 | 3300042616 | Bacteria | 9711 |
| 90 | Ga0466713_045333 | 3300042602 | Bacteria | 40925 |
| 91 | Ga0466713_090788 | 3300042602 | Bacteria | 2400 |
| 92 | Ga0123356_10094050 | 3300010049 | Bacteria | 2862 |
| 93 | Ga0123353_10033470 | 3300010167 | Bacteria | 8005 |
| 94 | Ga0123353_10071820 | 3300010167 | Bacteria | 5562 |
| 95 | Ga0123354_10014826 | 3300010882 | Bacteria | 12141 |
| 96 | Ga0466703_070159 | 3300042636 | Bacteria | 9157 |
| 97 | Ga0466709_372905 | 3300042648 | Bacteria | 38102 |
| 98 | Ga0160436_1002830 | 3300012861 | Bacteria | 4328 |
| 99 | Ga0466691_094895 | 3300042593 | Bacteria | 7062 |
| 100 | Ga0466696_360462 | 3300042596 | Bacteria | 1487 |
| 101 | IMNBL1DRAFT_c0027856 | 3300000062 | Bacteria | 2118 |
| 102 | Ga0072941_1398277 | 3300005201 | Unclassified | 1765 |
| 103 | Ga0466705_181342 | 3300042612 | Bacteria | 10357 |
| 104 | Ga0466711_411906 | 3300042615 | Bacteria | 26972 |
| 105 | Ga0466723_103742 | 3300042618 | Bacteria | 2237 |
| 106 | Ga0466707_163876 | 3300042601 | Bacteria | 13368 |
| 107 | Ga0466707_172760 | 3300042601 | Bacteria | 3215 |
| 108 | Ga0466713_029889 | 3300042602 | Bacteria | 53582 |
| 109 | Ga0123356_10250326 | 3300010049 | Bacteria | 1849 |
| 110 | Ga0466703_233541 | 3300042636 | Bacteria | 4978 |
| 111 | IMNBL1DRAFT_c0017153 | 3300000062 | Bacteria | 3064 |
| 112 | Ga0068305_10598301 | 3300005083 | Unclassified | 3295 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.