Protein Family IF02778
Metagenome
Isolate
326
Members
217
Samples
189
Scaffolds
279.56
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10080241|Ga0123356_100802412
- Length
- 309 aa
- Sequence
- VPRARSARPSSRGRREPERGGAHGRWRQPQVMQLAGHEVGTGQPLFLIAGPCVIESPTLTQEIAGRLKEVTARLRIPYIFKASYDKANRSSQGSFRGPGIDAGLKVLEGVRRAVGVPVLTDVHEDTPLGEVAAVVDVLQTPAFLCRQTNFIVNTASQGKPVNIKKGQFLSPWEMQNVVDKARSTGNEHIMVCERGFSFGYNNLVSDMRSLSILRATGCPVVFDATHSVQLPGGRGSSSGGQREFIPVLARAAVAAGVAGLFMETHPRPEEALSDGPNAWPLARMEPLLTTLTELDRAVKKVPFEESLL*
Sample Types
Isolate
42.0%
Metagenome
58.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
38.3%
Termitidae
11.5%
Formicidae
9.1%
Unclassified
7.7%
Kalotermitidae
5.7%
Elmidae
5.3%
Culicidae
4.3%
Ixodidae
3.3%
Armadillidiidae
3.3%
Argasidae
1.9%
Curculionidae
1.4%
Hydrophilidae
1.4%
Rhinotermitidae
1.0%
Berytidae
1.0%
Alydidae
1.0%
Largidae
1.0%
Termopsidae
1.0%
Sarcophagidae
0.5%
Passalidae
0.5%
Stratiomyidae
0.5%
Cixiidae
0.5%
Taxonomy
Archaea
0
Bacteria
315
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 2 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 3 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 4 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 5 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 6 | 2871564055 | Francisella tularensis holarctica FT9C-G7 | Isolate | Ixodidae |
| 7 | 2874203443 | Francisella tularensis holarctica FT8C-4F | Isolate | Ixodidae |
| 8 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 9 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 10 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 11 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 12 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 13 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 14 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 15 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 16 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 17 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 18 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 19 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 20 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 21 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 22 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 23 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 26 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 27 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 28 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 29 | 2791354885 | Francisella endosymbiont of Ornithodoros moubata FLE-Om | Isolate | Argasidae |
| 30 | 2806310685 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 31 | 2820056190 | Unclassified Proteobacteria Nt197P4bin9 | Isolate | Unclassified |
| 32 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 33 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 34 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 35 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 38 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 39 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 40 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 41 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 42 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 43 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 44 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 45 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 46 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 47 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 48 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 49 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 50 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 51 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 52 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 53 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 54 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 55 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 56 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 57 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 58 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 59 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 60 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 61 | 2788500057 | Francisella-like endosymbiont F-Om | Isolate | Argasidae |
| 62 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 63 | 2820080004 | Unclassified Proteobacteria Lab288P4bin34 | Isolate | Unclassified |
| 64 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 65 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 66 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 67 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 68 | 2871595141 | Francisella tularensis 503 | Isolate | Ixodidae |
| 69 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 70 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 71 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 72 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 73 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 74 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 75 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 76 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 77 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 78 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 79 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 80 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 81 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 82 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 83 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 84 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 85 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 86 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 87 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 88 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 89 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 90 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 91 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 92 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 93 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 94 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 95 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 96 | 2791354884 | Francisella endosymbiont of Amblyomma maculatum FLE-Am | Isolate | Ixodidae |
| 97 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 98 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 99 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 100 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 101 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 102 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 103 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 104 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 105 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 106 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 107 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 108 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 109 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 110 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 111 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 112 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 113 | 3002773460 | Coxiella endosymbiont of Amblyomma nuttalli Craf2019 | Isolate | Ixodidae |
| 114 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 115 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 116 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 117 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 118 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 119 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 120 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 121 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 122 | 2832201259 | Rickettsiella grylli TrM1 | Isolate | Unclassified |
| 123 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 124 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 125 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 126 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 127 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 128 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 129 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 130 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 131 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 132 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 133 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 134 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 135 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 136 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 137 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 138 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 139 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 140 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 141 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 142 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 143 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 144 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 145 | 2562617066 | Rickettsiella grylli AAQJ | Isolate | Armadillidiidae |
| 146 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 147 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 148 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 149 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 150 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 151 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 152 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 153 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 154 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 155 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 156 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 157 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 158 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 159 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 160 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 161 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 162 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 163 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 164 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 165 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 166 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 167 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 168 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 169 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 170 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 171 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 172 | 2772190782 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 173 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 174 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 175 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 176 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 177 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 178 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 179 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 180 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 181 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 182 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 183 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 184 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 185 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 186 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 187 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 188 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 189 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 190 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 191 | 2506210010 | Francisella tularensis tularensis FSC041 | Isolate | |
| 192 | 2506210015 | Francisella tularensis holarctica FSC185 | Isolate | |
| 193 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 194 | 2874209778 | Francisella tularensis holarctica FT16C-B1 | Isolate | Ixodidae |
| 195 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 196 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 197 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 198 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 199 | 637000113 | Francisella tularensis tularensis FSC 198 | Isolate | |
| 200 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 201 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 202 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 203 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 204 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 205 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 206 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 207 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 208 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 209 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 210 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 211 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 212 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 213 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 214 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 215 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 216 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 217 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_093277 | 3300042611 | Bacteria | 2569 |
| 2 | Ga0466705_311150 | 3300042612 | Bacteria | 166746 |
| 3 | Ga0466710_107916 | 3300042613 | Bacteria | 1094 |
| 4 | Ga0466718_010427 | 3300042617 | Bacteria | 4610 |
| 5 | Ga0466730_055720 | 3300042625 | Bacteria | 4117 |
| 6 | Ga0466725_241563 | 3300042654 | Bacteria | 75848 |
| 7 | Ga0466725_317547 | 3300042654 | Bacteria | 12290 |
| 8 | Ga0160467_100860 | 3300012829 | Unclassified | 19335 |
| 9 | Ga0160447_108274 | 3300012849 | Bacteria | 2507 |
| 10 | Ga0160447_108412 | 3300012849 | Unclassified | 2471 |
| 11 | Ga0160436_1000644 | 3300012861 | Unclassified | 12005 |
| 12 | Ga0415639_004022 | 3300038395 | Bacteria | 2626 |
| 13 | Ga0466693_400643 | 3300042592 | Bacteria | 4650 |
| 14 | Ga0466695_105802 | 3300042595 | Bacteria | 5846 |
| 15 | Ga0160466_100023 | 3300012809 | Bacteria | 285785 |
| 16 | Ga0160471_106194 | 3300012812 | Bacteria | 1518 |
| 17 | IMNBGM34_c000673 | 3300000036 | Bacteria | 8300 |
| 18 | Ga0102735_1000064 | 3300007080 | Bacteria | 53865 |
| 19 | Ga0102739_1005580 | 3300007095 | Bacteria | 1715 |
| 20 | Ga0102734_1029275 | 3300007129 | Bacteria | 2190 |
| 21 | Ga0102740_1001868 | 3300007140 | Bacteria | 5101 |
| 22 | Ga0102737_1001428 | 3300007142 | Bacteria | 6652 |
| 23 | Ga0103264_1000007 | 3300007188 | Bacteria | 144836 |
| 24 | Ga0103264_1000894 | 3300007188 | Bacteria | 13451 |
| 25 | Ga0466701_069503 | 3300042598 | Bacteria | 91243 |
| 26 | Ga0466725_081387 | 3300042654 | Bacteria | 22327 |
| 27 | Ga0160440_100119 | 3300012815 | Bacteria | 78831 |
| 28 | Ga0160433_100314 | 3300012846 | Bacteria | 30998 |
| 29 | Ga0123357_10005748 | 3300009784 | Bacteria | 14939 |
| 30 | Ga0123356_10080241 | 3300010049 | Bacteria | 3084 |
| 31 | Ga0123356_10262739 | 3300010049 | Bacteria | 1811 |
| 32 | Ga0160466_105124 | 3300012809 | Bacteria | 1781 |
| 33 | IMNBGM34_c000927 | 3300000036 | Bacteria | 6365 |
| 34 | JGI24705J35276_12236565 | 3300002504 | Bacteria | 8334 |
| 35 | CVPL005L_10042462 | 3300002938 | Unclassified | 1282 |
| 36 | Ga0103260_1000299 | 3300007139 | Bacteria | 9810 |
| 37 | Ga0102738_1014710 | 3300007141 | Bacteria | 1088 |
| 38 | Ga0102737_1000610 | 3300007142 | Bacteria | 11596 |
| 39 | Ga0103264_1000748 | 3300007188 | Bacteria | 15219 |
| 40 | Ga0103264_1052991 | 3300007188 | Bacteria | 1546 |
| 41 | Ga0466701_023499 | 3300042598 | Bacteria | 2338 |
| 42 | Ga0466716_133844 | 3300042605 | Bacteria | 9554 |
| 43 | Ga0466719_232588 | 3300042606 | Bacteria | 3959 |
| 44 | Ga0466734_078952 | 3300042623 | Bacteria | 8331 |
| 45 | Ga0466703_051818 | 3300042636 | Bacteria | 6790 |
| 46 | Ga0466703_432287 | 3300042636 | Bacteria | 3135 |
| 47 | Ga0466724_42462 | 3300042649 | Bacteria | 351483 |
| 48 | Ga0466725_116312 | 3300042654 | Bacteria | 6907 |
| 49 | Ga0160432_100725 | 3300012818 | Bacteria | 16458 |
| 50 | Ga0160472_100371 | 3300012839 | Bacteria | 38656 |
| 51 | Ga0160434_102083 | 3300012850 | Bacteria | 3520 |
| 52 | Ga0415639_278816 | 3300038395 | Bacteria | 2944 |
| 53 | Ga0466690_139684 | 3300042590 | Bacteria | 11475 |
| 54 | Ga0123355_10061357 | 3300009826 | Bacteria | 6071 |
| 55 | Ga0123353_10332162 | 3300010167 | Bacteria | 2300 |
| 56 | Ga0123353_10415405 | 3300010167 | Bacteria | 1996 |
| 57 | Ga0160471_100016 | 3300012812 | Bacteria | 402972 |
| 58 | CVPL010W_10001564 | 3300002931 | Bacteria | 26866 |
| 59 | Ga0102740_1000129 | 3300007140 | Bacteria | 19930 |
| 60 | Ga0102738_1014067 | 3300007141 | Bacteria | 1109 |
| 61 | Ga0103264_1000567 | 3300007188 | Bacteria | 18626 |
| 62 | Ga0466701_077653 | 3300042598 | Bacteria | 304895 |
| 63 | Ga0466701_096100 | 3300042598 | Bacteria | 3279 |
| 64 | Ga0466717_003492 | 3300042604 | Bacteria | 5023 |
| 65 | Ga0466722_247357 | 3300042609 | Bacteria | 288950 |
| 66 | Ga0466697_045293 | 3300042611 | Bacteria | 2250 |
| 67 | Ga0466710_072988 | 3300042613 | Bacteria | 5702 |
| 68 | Ga0466710_076766 | 3300042613 | Bacteria | 16294 |
| 69 | Ga0466715_047484 | 3300042616 | Bacteria | 34891 |
| 70 | Ga0466724_16812 | 3300042649 | Bacteria | 126976 |
| 71 | Ga0466725_102756 | 3300042654 | Bacteria | 11673 |
| 72 | Ga0466727_085772 | 3300042655 | Bacteria | 22474 |
| 73 | Ga0160472_101048 | 3300012839 | Bacteria | 9669 |
| 74 | Ga0160445_100005 | 3300012847 | Bacteria | 401996 |
| 75 | Ga0160430_106051 | 3300012852 | Bacteria | 2653 |
| 76 | Ga0160436_1000133 | 3300012861 | Bacteria | 37976 |
| 77 | Ga0466657_199262 | 3300042582 | Bacteria | 14589 |
| 78 | Ga0466657_233508 | 3300042582 | Bacteria | 1418 |
| 79 | Ga0123357_10088391 | 3300009784 | Bacteria | 4049 |
| 80 | Ga0123353_10667521 | 3300010167 | Bacteria | 1467 |
| 81 | Ga0123353_10856401 | 3300010167 | Bacteria | 1245 |
| 82 | Ga0123354_10000052 | 3300010882 | Bacteria | 88097 |
| 83 | Ga0123354_10026529 | 3300010882 | Bacteria | 9138 |
| 84 | CVPL010W_10005276 | 3300002931 | Unclassified | 13900 |
| 85 | Ga0102735_1001153 | 3300007080 | Bacteria | 4671 |
| 86 | Ga0103261_1000371 | 3300007083 | Bacteria | 6903 |
| 87 | Ga0102739_1000022 | 3300007095 | Bacteria | 83604 |
| 88 | Ga0102734_1027581 | 3300007129 | Bacteria | 1449 |
| 89 | Ga0102738_1000012 | 3300007141 | Bacteria | 104606 |
| 90 | Ga0466701_021249 | 3300042598 | Bacteria | 30446 |
| 91 | Ga0466701_044683 | 3300042598 | Bacteria | 27504 |
| 92 | Ga0466733_029354 | 3300042659 | Bacteria | 2369 |
| 93 | Ga0466733_088899 | 3300042659 | Bacteria | 1464 |
| 94 | Ga0466710_060774 | 3300042613 | Bacteria | 6383 |
| 95 | Ga0466715_479096 | 3300042616 | Bacteria | 2000 |
| 96 | Ga0466734_127123 | 3300042623 | Bacteria | 6128 |
| 97 | Ga0466724_35850 | 3300042649 | Bacteria | 120573 |
| 98 | Ga0466725_009848 | 3300042654 | Bacteria | 2700 |
| 99 | Ga0160470_106734 | 3300012813 | Unclassified | 1298 |
| 100 | Ga0160472_105769 | 3300012839 | Bacteria | 1940 |
| 101 | Ga0160460_103635 | 3300012845 | Bacteria | 2644 |
| 102 | Ga0160435_1000532 | 3300012857 | Bacteria | 11936 |
| 103 | Ga0160435_1005927 | 3300012857 | Bacteria | 2735 |
| 104 | Ga0466657_204968 | 3300042582 | Bacteria | 2659 |
| 105 | Ga0466690_142660 | 3300042590 | Bacteria | 40464 |
| 106 | Ga0466692_016490 | 3300042591 | Bacteria | 11922 |
| 107 | Ga0466693_189608 | 3300042592 | Bacteria | 1810 |
| 108 | Ga0466691_127293 | 3300042593 | Bacteria | 19896 |
| 109 | JGI24699J35502_10928434 | 3300002509 | Bacteria | 1112 |
| 110 | Ga0102738_1002354 | 3300007141 | Bacteria | 2825 |
| 111 | Ga0102737_1000180 | 3300007142 | Bacteria | 36236 |
| 112 | Ga0123357_10000248 | 3300009784 | Bacteria | 51506 |
| 113 | Ga0466701_016197 | 3300042598 | Bacteria | 39239 |
| 114 | Ga0466701_031552 | 3300042598 | Bacteria | 1169 |
| 115 | Ga0466697_025137 | 3300042611 | Bacteria | 2848 |
| 116 | Ga0466705_178621 | 3300042612 | Bacteria | 90956 |
| 117 | Ga0466732_076278 | 3300042656 | Bacteria | 95751 |
| 118 | Ga0466711_059368 | 3300042615 | Bacteria | 2364 |
| 119 | Ga0466726_143850 | 3300042619 | Bacteria | 4164 |
| 120 | Ga0466734_070958 | 3300042623 | Bacteria | 8225 |
| 121 | Ga0466734_098091 | 3300042623 | Bacteria | 6001 |
| 122 | Ga0466734_102458 | 3300042623 | Bacteria | 1816 |
| 123 | Ga0466730_031103 | 3300042625 | Unclassified | 4003 |
| 124 | Ga0466703_290279 | 3300042636 | Bacteria | 16011 |
| 125 | Ga0466704_273906 | 3300042643 | Bacteria | 6599 |
| 126 | Ga0160467_100001 | 3300012829 | Bacteria | 1734829 |
| 127 | Ga0160459_100089 | 3300012831 | Bacteria | 102263 |
| 128 | Ga0160443_101424 | 3300012848 | Bacteria | 8129 |
| 129 | Ga0160457_1000027 | 3300012858 | Bacteria | 297202 |
| 130 | Ga0160457_1000042 | 3300012858 | Bacteria | 211595 |
| 131 | Ga0160457_1000734 | 3300012858 | Bacteria | 12141 |
| 132 | Ga0466657_050740 | 3300042582 | Bacteria | 2897 |
| 133 | Ga0466657_249994 | 3300042582 | Bacteria | 28084 |
| 134 | Ga0466691_082553 | 3300042593 | Bacteria | 46868 |
| 135 | Ga0123356_10086296 | 3300010049 | Bacteria | 2979 |
| 136 | Ga0103263_100729 | 3300007042 | Bacteria | 4480 |
| 137 | Ga0102736_1000549 | 3300007052 | Bacteria | 7525 |
| 138 | Ga0103265_1000407 | 3300007068 | Bacteria | 7312 |
| 139 | Ga0103260_1001076 | 3300007139 | Unclassified | 5006 |
| 140 | Ga0102738_1000081 | 3300007141 | Bacteria | 36237 |
| 141 | Ga0103267_1000027 | 3300007190 | Bacteria | 53284 |
| 142 | Ga0105524_100650 | 3300007733 | Bacteria | 5429 |
| 143 | Ga0466701_076363 | 3300042598 | Bacteria | 43029 |
| 144 | Ga0466707_103383 | 3300042601 | Bacteria | 21094 |
| 145 | Ga0466697_121726 | 3300042611 | Bacteria | 6359 |
| 146 | Ga0466715_357484 | 3300042616 | Bacteria | 57051 |
| 147 | Ga0466734_098996 | 3300042623 | Bacteria | 21366 |
| 148 | Ga0466734_162269 | 3300042623 | Bacteria | 3331 |
| 149 | Ga0466730_029404 | 3300042625 | Bacteria | 69048 |
| 150 | Ga0466730_078531 | 3300042625 | Bacteria | 132731 |
| 151 | Ga0466703_238599 | 3300042636 | Bacteria | 7902 |
| 152 | Ga0466708_096807 | 3300042652 | Bacteria | 14346 |
| 153 | Ga0160467_100464 | 3300012829 | Bacteria | 39612 |
| 154 | Ga0466657_039117 | 3300042582 | Bacteria | 1316 |
| 155 | Ga0123355_10204899 | 3300009826 | Unclassified | 2872 |
| 156 | Ga0123356_10099337 | 3300010049 | Bacteria | 2789 |
| 157 | Ga0123354_10000087 | 3300010882 | Bacteria | 68259 |
| 158 | CVPL010W_10006262 | 3300002931 | Bacteria | 14321 |
| 159 | CVPL005W_1000327 | 3300002934 | Unclassified | 20701 |
| 160 | Ga0102736_1000023 | 3300007052 | Bacteria | 70447 |
| 161 | Ga0103260_1000923 | 3300007139 | Bacteria | 5448 |
| 162 | Ga0102737_1011525 | 3300007142 | Unclassified | 1463 |
| 163 | Ga0103268_1000948 | 3300007192 | Bacteria | 7834 |
| 164 | Ga0466701_082473 | 3300042598 | Bacteria | 1345 |
| 165 | Ga0466721_216144 | 3300042608 | Bacteria | 3958 |
| 166 | Ga0466705_070465 | 3300042612 | Bacteria | 16060 |
| 167 | Ga0466705_111194 | 3300042612 | Bacteria | 28569 |
| 168 | Ga0466710_061683 | 3300042613 | Bacteria | 2128 |
| 169 | Ga0466728_046653 | 3300042620 | Bacteria | 14589 |
| 170 | Ga0466730_006458 | 3300042625 | Bacteria | 2279 |
| 171 | Ga0466709_080644 | 3300042648 | Bacteria | 1516 |
| 172 | Ga0466724_02620 | 3300042649 | Bacteria | 10317 |
| 173 | Ga0466724_41048 | 3300042649 | Bacteria | 7429 |
| 174 | Ga0466725_059116 | 3300042654 | Bacteria | 97832 |
| 175 | Ga0160470_103328 | 3300012813 | Bacteria | 2623 |
| 176 | Ga0160440_100002 | 3300012815 | Bacteria | 1234951 |
| 177 | Ga0160444_100896 | 3300012841 | Bacteria | 7975 |
| 178 | Ga0160430_100434 | 3300012852 | Bacteria | 24417 |
| 179 | Ga0466657_306800 | 3300042582 | Bacteria | 3042 |
| 180 | Ga0466693_337227 | 3300042592 | Bacteria | 2505 |
| 181 | Ga0123355_10403242 | 3300009826 | Bacteria | 1762 |
| 182 | Ga0123353_10165295 | 3300010167 | Bacteria | 3518 |
| 183 | JGI24695J34938_10093226 | 3300002450 | Bacteria | 1234 |
| 184 | CVPL010W_10000661 | 3300002931 | Bacteria | 37920 |
| 185 | Ga0103263_100312 | 3300007042 | Bacteria | 6817 |
| 186 | Ga0103266_1000311 | 3300007067 | Bacteria | 11689 |
| 187 | Ga0103261_1000035 | 3300007083 | Bacteria | 82381 |
| 188 | Ga0102737_1000483 | 3300007142 | Bacteria | 13028 |
| 189 | Ga0103268_1019627 | 3300007192 | Bacteria | 1517 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00793 | DAHP_synth_1 | DAHP synthetase I family | 38 | 299 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00793 | GO:0009058 | biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.