Protein Family IF02766

Metagenome Isolate
112 Members
43 Samples
107 Scaffolds
133.99 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10065822|Ga0123356_100658222
Length
153 aa
Sequence
MKIVLDANIYISSFFWGGNPKTVLERAISEKDDLFISREILNEIEDVINRPKFHAEKDEIKYFIKAIEEIANIITIKNKLVKGSRDIKDDKYLECAVACNADYIISGDIHLLEIKQYKNIKIVTAKEYLELTPPPIKTNPSAGQAQKKTVQD*

📊 Sample Types

Isolate 4.5%
Metagenome 95.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 53.7%
Kalotermitidae 24.4%
Unclassified 12.2%
Rhinotermitidae 7.3%
Termopsidae 2.4%

🌳 Taxonomy

Archaea 1
Bacteria 94
Eukaryota 0
Viruses 1
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
2 2820018428 Unclassified Spirochaetes Nt197P3bin33 Isolate Unclassified
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
10 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
11 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
12 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
13 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
21 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
22 2778260941 Unclassified Fibrobacteres Th196P3bin8 Isolate Unclassified
23 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
26 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
27 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
28 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
32 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
33 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
34 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
35 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
36 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
37 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
38 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
39 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
40 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
41 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
42 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
43 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 AustNasuHG_c1045240 3300000089 Bacteria 1009
2 JGI24698J34947_10024475 3300002449 Bacteria 3224
3 Ga0072940_1001400 3300005200 Unclassified 14261
4 Ga0466712_269674 3300042614 Bacteria 4175
5 Ga0466712_311807 3300042614 Bacteria 2810
6 Ga0466690_362419 3300042590 Bacteria 1442
7 Ga0466694_059270 3300042594 Unclassified 1152
8 Ga0466699_190131 3300042597 Bacteria 1305
9 Ga0466700_024852 3300042600 Bacteria 1687
10 Ga0466700_100070 3300042600 Bacteria 1406
11 Ga0466698_199101 3300042610 Bacteria 1015
12 Ga0466703_050560 3300042636 Bacteria 1482
13 Ga0466708_087419 3300042652 Bacteria 2331
14 Ga0466732_164813 3300042656 Bacteria 6332
15 Ga0123356_11070972 3300010049 Bacteria 975
16 JGI24695J34938_10175358 3300002450 Bacteria 886
17 Ga0074263_110072 3300005485 Bacteria 1525
18 Ga0466712_010738 3300042614 Bacteria 3874
19 Ga0466728_109226 3300042620 Unclassified 1187
20 Ga0466720_009046 3300042607 Bacteria 19213
21 Ga0466722_122964 3300042609 Unclassified 1866
22 Ga0466705_188086 3300042612 Bacteria 1223
23 Ga0466705_248406 3300042612 Bacteria 4729
24 Ga0123353_11036593 3300010167 Unclassified 1097
25 AustNasuHG_c1028055 3300000089 Unclassified 1694
26 Ga0466718_091497 3300042617 Bacteria 5474
27 Ga0466723_107453 3300042618 Bacteria 1394
28 Ga0466726_150700 3300042619 Bacteria 1004
29 Ga0466690_087749 3300042590 Bacteria 1349
30 Ga0466700_373754 3300042600 Bacteria 1236
31 Ga0466719_183478 3300042606 Unclassified 3846
32 Ga0466719_272167 3300042606 Bacteria 10076
33 Ga0466698_457586 3300042610 Bacteria 1062
34 Ga0466702_305988 3300042635 Bacteria 1598
35 Ga0466703_260534 3300042636 Bacteria 2169
36 Ga0466704_038591 3300042643 Bacteria 8262
37 Ga0466704_221779 3300042643 Bacteria 6681
38 Ga0123353_10935072 3300010167 Bacteria 1175
39 Ga0123353_13264043 3300010167 Bacteria 518
40 AustNasuHG_c1068632 3300000089 Bacteria 648
41 JGI24698J34947_10052896 3300002449 Bacteria 2035
42 JGI24698J34947_10166769 3300002449 Unclassified 896
43 JGI24702J35022_10041266 3300002462 Bacteria 2460
44 Ga0072941_1000560 3300005201 Bacteria 18558
45 Ga0072941_1007804 3300005201 Bacteria 5128
46 Ga0072941_1016624 3300005201 Bacteria 2227
47 Ga0072941_1286518 3300005201 Bacteria 3424
48 Ga0466712_038865 3300042614 Bacteria 1528
49 Ga0466711_044750 3300042615 Bacteria 1348
50 Ga0466718_073994 3300042617 Bacteria 1338
51 Ga0466718_155311 3300042617 Unclassified 1812
52 Ga0456237_0004816 3300041968 Bacteria 2159
53 Ga0466690_070477 3300042590 Bacteria 1443
54 Ga0466693_231650 3300042592 Bacteria 1102
55 Ga0466695_223101 3300042595 Bacteria 1004
56 Ga0466720_066963 3300042607 Bacteria 6018
57 Ga0466722_019748 3300042609 Bacteria 4781
58 Ga0466698_163117 3300042610 Bacteria 2586
59 Ga0466702_199920 3300042635 Bacteria 3335
60 Ga0466708_099974 3300042652 Bacteria 10458
61 Ga0123356_10065822 3300010049 Bacteria 3391
62 Ga0072941_1004900 3300005201 Bacteria 3933
63 Ga0072941_1157942 3300005201 Bacteria 683
64 Ga0466712_253703 3300042614 Bacteria 1951
65 Ga0466718_148895 3300042617 Bacteria 6344
66 Ga0466728_019259 3300042620 Bacteria 3474
67 Ga0264413_127043 3300024493 Bacteria 2742
68 Ga0415639_046657 3300038395 Unclassified 1854
69 Ga0456237_0021635 3300041968 Bacteria 887
70 Ga0466692_131617 3300042591 Unclassified 2431
71 Ga0466698_429922 3300042610 Unclassified 1101
72 Ga0466702_393400 3300042635 Bacteria 2935
73 Ga0466732_347723 3300042656 Bacteria 7156
74 Ga0123353_10373845 3300010167 Bacteria 2135
75 AustNasuHG_c1001053 3300000089 Bacteria 9922
76 JGI24698J34947_10150777 3300002449 Bacteria 966
77 Ga0466723_128967 3300042618 Bacteria 9683
78 Ga0264413_102817 3300024493 Bacteria 10440
79 Ga0264413_109275 3300024493 Bacteria 7298
80 Ga0466722_042783 3300042609 Unclassified 1338
81 Ga0466709_301701 3300042648 Bacteria 4836
82 Ga0123356_10004683 3300010049 Unclassified 14087
83 Ga0123356_10674943 3300010049 Bacteria 1201
84 JGI24698J34947_10152034 3300002449 Viruses 960
85 JGI24702J35022_10006594 3300002462 Bacteria 6704
86 JGI24699J35502_10570879 3300002509 Bacteria 661
87 Ga0466712_308845 3300042614 Bacteria 1007
88 Ga0466718_101803 3300042617 Bacteria 1193
89 Ga0264413_106125 3300024493 Bacteria 2424
90 Ga0466692_123015 3300042591 Bacteria 9430
91 Ga0466694_143178 3300042594 Bacteria 1803
92 Ga0466695_015040 3300042595 Archaea 1050
93 Ga0466698_439462 3300042610 Bacteria 1176
94 Ga0466703_375312 3300042636 Bacteria 2704
95 Ga0466708_354188 3300042652 Bacteria 1494
96 Ga0466733_109553 3300042659 Bacteria 1086
97 Ga0123356_10580597 3300010049 Unclassified 1284
98 AustNasuHG_c1055226 3300000089 Unclassified 810
99 JGI24698J34947_10030690 3300002449 Bacteria 2833
100 JGI24698J34947_10040751 3300002449 Bacteria 2396
101 Ga0072940_1010446 3300005200 Bacteria 1233
102 Ga0466718_050315 3300042617 Bacteria 3214
103 Ga0466728_001724 3300042620 Bacteria 7950
104 Ga0466728_369260 3300042620 Bacteria 16192
105 Ga0466700_005009 3300042600 Bacteria 1032
106 Ga0466709_116522 3300042648 Bacteria 1543
107 Ga0466709_150274 3300042648 Bacteria 17049

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300000089 AustNasuHG_c1001053 AustNasuHG_10010532 121
2 3300005200 Ga0072940_1001400 Ga0072940_10014006 121
3 3300000089 AustNasuHG_c1028055 AustNasuHG_10280553 123
4 3300042609 Ga0466722_042783 Ga0466722_042783_795_1166 123
5 3300042606 Ga0466719_183478 Ga0466719_183478_573_953 126
6 3300005201 Ga0072941_1286518 Ga0072941_12865183 129
7 3300005201 Ga0072941_1157942 Ga0072941_11579422 130
8 3300042652 Ga0466708_099974 Ga0466708_099974_9654_10046 130
9 3300002450 JGI24695J34938_10175358 JGI24695J34938_101753581 132
10 3300002462 JGI24702J35022_10006594 JGI24702J35022_1000659410 132
11 3300010049 Ga0123356_11070972 Ga0123356_110709722 132
12 3300024493 Ga0264413_106125 Ga0264413_1061253 132
13 3300042615 Ga0466711_044750 Ga0466711_044750_628_1026 132
14 3300042635 Ga0466702_199920 Ga0466702_199920_1694_2092 132
15 3300042643 Ga0466704_221779 Ga0466704_221779_4563_4961 132
16 iso_pr_bacteria 2740892545 2743908803 132
17 3300000089 AustNasuHG_c1045240 AustNasuHG_10452403 133
18 3300005201 Ga0072941_1000560 Ga0072941_100056012 133
19 3300005201 Ga0072941_1004900 Ga0072941_10049002 133
20 3300024493 Ga0264413_109275 Ga0264413_1092752 133
21 3300041968 Ga0456237_0004816 Ga0456237_0004816_1550_1951 133
22 3300041968 Ga0456237_0021635 Ga0456237_0021635_387_788 133
23 3300042590 Ga0466690_070477 Ga0466690_070477_493_894 133
24 3300042590 Ga0466690_087749 Ga0466690_087749_588_989 133
25 3300042590 Ga0466690_362419 Ga0466690_362419_451_852 133
26 3300042591 Ga0466692_123015 Ga0466692_123015_682_1083 133
27 3300042591 Ga0466692_131617 Ga0466692_131617_1970_2371 133
28 3300042597 Ga0466699_190131 Ga0466699_190131_497_898 133
29 3300042600 Ga0466700_005009 Ga0466700_005009_31_432 133
30 3300042600 Ga0466700_024852 Ga0466700_024852_1124_1525 133
31 3300042600 Ga0466700_100070 Ga0466700_100070_992_1393 133
32 3300042600 Ga0466700_373754 Ga0466700_373754_629_1030 133
33 3300042606 Ga0466719_272167 Ga0466719_272167_9212_9613 133
34 3300042607 Ga0466720_009046 Ga0466720_009046_16694_17095 133
35 3300042607 Ga0466720_066963 Ga0466720_066963_441_842 133
36 3300042610 Ga0466698_199101 Ga0466698_199101_347_748 133
37 3300042610 Ga0466698_429922 Ga0466698_429922_154_555 133
38 3300042610 Ga0466698_439462 Ga0466698_439462_178_579 133
39 3300042610 Ga0466698_457586 Ga0466698_457586_275_676 133
40 3300042612 Ga0466705_248406 Ga0466705_248406_392_793 133
41 3300042614 Ga0466712_010738 Ga0466712_010738_1410_1811 133
42 3300042614 Ga0466712_038865 Ga0466712_038865_531_932 133
43 3300042614 Ga0466712_269674 Ga0466712_269674_79_480 133
44 3300042614 Ga0466712_308845 Ga0466712_308845_125_526 133
45 3300042614 Ga0466712_311807 Ga0466712_311807_1595_1996 133
46 3300042617 Ga0466718_073994 Ga0466718_073994_188_589 133
47 3300042617 Ga0466718_091497 Ga0466718_091497_165_566 133
48 3300042617 Ga0466718_101803 Ga0466718_101803_160_561 133
49 3300042618 Ga0466723_107453 Ga0466723_107453_686_1087 133
50 3300042618 Ga0466723_128967 Ga0466723_128967_187_588 133
51 3300042619 Ga0466726_150700 Ga0466726_150700_172_573 133
52 3300042620 Ga0466728_019259 Ga0466728_019259_426_827 133
53 3300042620 Ga0466728_109226 Ga0466728_109226_271_672 133
54 3300042635 Ga0466702_393400 Ga0466702_393400_1644_2045 133
55 3300042636 Ga0466703_050560 Ga0466703_050560_394_795 133
56 3300042636 Ga0466703_260534 Ga0466703_260534_1407_1808 133
57 3300042636 Ga0466703_375312 Ga0466703_375312_806_1207 133
58 3300042643 Ga0466704_038591 Ga0466704_038591_7394_7795 133
59 3300042648 Ga0466709_116522 Ga0466709_116522_553_954 133
60 3300042648 Ga0466709_150274 Ga0466709_150274_16466_16867 133
61 3300042648 Ga0466709_301701 Ga0466709_301701_3509_3910 133
62 3300042652 Ga0466708_087419 Ga0466708_087419_445_846 133
63 3300042652 Ga0466708_354188 Ga0466708_354188_496_897 133
64 3300042656 Ga0466732_164813 Ga0466732_164813_4195_4596 133
65 3300042656 Ga0466732_347723 Ga0466732_347723_5730_6131 133
66 iso_pr_bacteria 2820018428 2820018819 133
67 3300002449 JGI24698J34947_10030690 JGI24698J34947_100306902 134
68 3300002449 JGI24698J34947_10052896 JGI24698J34947_100528962 134
69 3300002449 JGI24698J34947_10150777 JGI24698J34947_101507772 134
70 3300002449 JGI24698J34947_10152034 JGI24698J34947_101520342 134
71 3300002462 JGI24702J35022_10041266 JGI24702J35022_100412663 134
72 3300002509 JGI24699J35502_10570879 JGI24699J35502_105708791 134
73 3300005200 Ga0072940_1010446 Ga0072940_10104462 134
74 3300005201 Ga0072941_1016624 Ga0072941_10166242 134
75 3300005485 Ga0074263_110072 Ga0074263_1100722 134
76 3300010167 Ga0123353_10373845 Ga0123353_103738454 134
77 3300010167 Ga0123353_10935072 Ga0123353_109350722 134
78 3300024493 Ga0264413_127043 Ga0264413_1270437 134
79 3300038395 Ga0415639_046657 Ga0415639_046657_1173_1577 134
80 3300042610 Ga0466698_163117 Ga0466698_163117_2078_2482 134
81 3300042612 Ga0466705_188086 Ga0466705_188086_299_703 134
82 3300042617 Ga0466718_050315 Ga0466718_050315_2610_3014 134
83 3300042635 Ga0466702_305988 Ga0466702_305988_418_822 134
84 3300042659 Ga0466733_109553 Ga0466733_109553_183_587 134
85 3300000089 AustNasuHG_c1055226 AustNasuHG_10552262 135
86 3300000089 AustNasuHG_c1068632 AustNasuHG_10686322 135
87 3300010049 Ga0123356_10674943 Ga0123356_106749432 135
88 3300010167 Ga0123353_11036593 Ga0123353_110365933 135
89 3300042609 Ga0466722_019748 Ga0466722_019748_851_1258 135
90 3300042609 Ga0466722_122964 Ga0466722_122964_1164_1571 135
91 3300042614 Ga0466712_253703 Ga0466712_253703_697_1104 135
92 iso_pr_bacteria 2781125695 2781437578 136
93 3300010049 Ga0123356_10580597 Ga0123356_105805971 137
94 iso_pr_bacteria 2778260941 2778358907 137
95 3300042592 Ga0466693_231650 Ga0466693_231650_127_543 138
96 3300042594 Ga0466694_059270 Ga0466694_059270_196_612 138
97 3300042594 Ga0466694_143178 Ga0466694_143178_1275_1691 138
98 3300042595 Ga0466695_015040 Ga0466695_015040_206_622 138
99 3300042595 Ga0466695_223101 Ga0466695_223101_511_927 138
100 3300002449 JGI24698J34947_10040751 JGI24698J34947_100407513 139
101 3300002449 JGI24698J34947_10166769 JGI24698J34947_101667692 139
102 3300042620 Ga0466728_001724 Ga0466728_001724_2886_3305 139
103 3300042620 Ga0466728_369260 Ga0466728_369260_11076_11495 139
104 3300010167 Ga0123353_13264043 Ga0123353_132640432 140
105 3300042617 Ga0466718_155311 Ga0466718_155311_1036_1458 140
106 iso_pr_bacteria 2781125661 2781334174 140
107 3300002449 JGI24698J34947_10024475 JGI24698J34947_100244752 141
108 3300010049 Ga0123356_10004683 Ga0123356_100046835 141
109 3300042617 Ga0466718_148895 Ga0466718_148895_1853_2281 142
110 3300005201 Ga0072941_1007804 Ga0072941_10078041 143
111 3300024493 Ga0264413_102817 Ga0264413_1028173 145
112 3300010049 Ga0123356_10065822 Ga0123356_100658222 153

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13470 PIN_3 PIN domain 2 110 0.81

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.